KEGG   Clostridium botulinum H04402 065: H04402_01633Help
Entry
H04402_01633      CDS       T02076                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cbj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H04402_01633
  Amino acid metabolism
   00340 Histidine metabolism
    H04402_01633
Enzymes [BR:cbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     H04402_01633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1756873..1758183
Genome map
AA seq 436 aa AA seqDB search
MINVVKIGEDNKKQCMNNLKSRSKKVQKDVITSVKKILGDISENGDKALIKYTNKFDSKK
INLENIRVTLEEIKKAYELVDEEFIKAIKIAKENILFYHEKQKQRSWMVTKEDGIILGQQ
IRALETVGIYVPGGTAAYPSSVLMNTLPAKVAGVEKIVMITPPSKDGSVNPNILVAANIA
GVDEIYKAGGAQGIGALAYGTKIIPKVDKIVGPGNIYVAMAKRSVYGFVDIDMIAGPSEI
LIIADESSDPKFIAADFMSQAEHDVLASSMLVTTSERLAQKVKDQLNIQIKNLSRKEIIR
TSIKDYGAIFVVDNLEEAIELANDISPEHLEVMTEDPFTILGQIKNAGSVFLGKYAPEPL
GDYMAGPNHVLPTSGSARFFSPLSVDDYIKKSSFTYYTKRALEKVKDVTVTIAETEGLTA
HANSIRVRFDNNNFSF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgataaatgtggttaaaataggtgaagacaataaaaaacagtgcatgaataatttgaaa
agcaggtcaaaaaaagtacaaaaagatgtaattacttctgtaaaaaaaatactaggggac
ataagtgaaaatggggataaagcattaataaaatatactaataagtttgatagtaaaaaa
ataaatttagaaaatattagagttactttagaagagataaaaaaggcttatgaattagtt
gatgaagaatttataaaggctataaaaattgctaaagaaaatatattgttttatcatgag
aagcaaaaacaaagatcatggatggtaacaaaggaagatggaataattttaggtcagcaa
attagagctctagagactgtaggtatatacgttccaggaggaacagcagcttatccttct
tcagtattaatgaatacccttccagctaaagtagcaggagtagaaaaaatagttatgata
actcctccttctaaggatgggagtgtaaatcctaatattttagtagctgctaatattgct
ggagttgatgaaatatataaagcaggaggagcacaaggaataggagctttagcttatgga
acaaaaatcataccaaaggtggataaaatagtaggtccaggtaatatatatgtggctatg
gccaaaagaagtgtttatggctttgtggatatagatatgatagcaggacctagtgaaatt
ttgattatagcagatgaaagttctgatcctaaatttatagcagcagattttatgtctcaa
gctgagcatgatgtattggcatcctcaatgttagttactacctccgagagattagcacaa
aaggtaaaagaccaattaaacatacagataaaaaatctttcaaggaaagaaataatacgt
acatctattaaagattatggtgctatttttgtagtagataatttagaagaagctatagaa
cttgctaatgatatatccccagaacatttagaggttatgacagaagaccccttcactatt
ttaggacaaattaaaaatgcaggttctgtattcttaggtaaatatgctccagaaccatta
ggggattatatggcaggaccaaatcatgtattgcctactagcggaagtgcaagatttttt
tcacctctttcagtagatgattatattaagaaatcaagtttcacatattacacaaaaagg
gcattggaaaaagtaaaggatgttactgtaaccattgctgaaacagagggattaactgcc
catgcaaattccataagagtgagatttgataacaataatttttcattttag

  All links  
No link information was found.   
DBGET integrated database retrieval system