KEGG   Clostridium botulinum H04402 065: H04402_02796Help
Entry
H04402_02796      CDS       T02076                                 

Definition
transmembrane phosphoenolpyruvate phosphomutase (EC:5.4.2.9)
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
cbj  Clostridium botulinum H04402 065
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:cbj00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2890176..2891480)
Genome map
AA seq 434 aa AA seqDB search
MKNKMSPSIYACFSTGVIHEGHMNIINEAKKYGSVIVGVLSDEACVKFDRFPTNKIEDRV
EMFEKLPQVNKVVIQKTTSYKDVLNELKPDYVIHGDNWNNGPQSVIRQETIEILKEWNGQ
LIEIPYTKNVNVKKVDDITREKLAMPEYRRKRLRQLLKLRPIVKAIEVHNGITGLIAEKT
VVERNGELDQFDAMWISSLCDSTAKGKPDIELVDMSSRLDTVNDVMEVTTKPIILDGDTG
GLVEHFVYNVRTLERMGVSAVIIEDKTGLKKNSLFGTEVHQTQDTVENFCHKISEAKEAL
RTDEFMIIARIESLILEQGMEDALNRAYAYVNAGADGVMIHSRKKDPTEIFEFCDKFRKT
DKDTPIVVVPTSFNTVAEEEFITHGVNIVIYANQLTRSAFPAMQQTATRILECHRAKEVD
DNLMSIKDIITLID
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaaatgagcccaagtatatatgcgtgctttagtacgggagttatccatgaa
ggacatatgaatattataaatgaggcaaaaaaatacggaagtgtaattgttggagtttta
agtgatgaagcttgtgttaaatttgatcgttttccaacaaataaaattgaagatagagtc
gaaatgtttgaaaagttaccacaagttaataaagtagttattcaaaaaactacttcttat
aaagatgtcctaaatgaattaaaacctgactacgtaattcatggtgataattggaataat
ggaccgcagtcagttataagacaagaaactattgaaatattaaaggaatggaatggacaa
ttaattgaaattccatatacaaaaaatgtaaatgtaaaaaaagttgatgatattacaaga
gaaaagttggcaatgcctgaatatcgtaggaagagattaagacagttgttaaagctacgt
ccaattgtaaaggctatagaagtacataatggaattactgggttaattgcagaaaaaacc
gttgttgagcgcaatggagaacttgatcagtttgatgcaatgtggatttcaagtctttgt
gattctactgcaaagggaaaacctgatattgaattagttgatatgtcttcaaggcttgat
acagttaatgatgttatggaagttacaactaaacctattatattagatggagatacaggt
ggattggtagaacattttgtatataatgtaagaactcttgaaagaatgggggtttctgca
gttattattgaagataaaactggtcttaagaaaaattcattattcggaacagaggttcat
cagactcaagatactgttgaaaacttttgtcataaaatcagtgaagcaaaagaggctctt
agaactgatgagtttatgattatagcaagaattgaaagtttaattcttgaacaaggtatg
gaagatgctttaaacagagcttatgcttatgtgaatgcaggtgctgatggagttatgata
cacagccgtaaaaaagatcctacagaaatatttgaattctgtgataaatttagaaaaacg
gataaagatacaccaatcgttgttgtacctacttcttttaacactgttgcggaggaagag
tttattacacatggagtaaatattgtaatttatgccaatcagctgacaagaagtgcattt
cctgcaatgcaacaaacagcaacgagaattcttgaatgtcatagagcaaaagaagtggat
gataacttaatgtcaataaaagatattattacattaattgactaa

DBGET integrated database retrieval system