KEGG   Clostridium botulinum B Eklund 17B: CLL_A0062Help
Entry
CLL_A0062         CDS       T00696                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cbk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
64352..65161
Genome map
AA seq 269 aa AA seqDB search
MGFRKNLINANRIVVKVGTSTLTYDNGNINLRRIERLTRVLSDIVNSGKEVVLVTSGAIG
VGVSKLKLKEKPQNIREKQAVASVGQCELMHIYSKFFGEYSHVVGQVLLTRDVVEDDHIR
ENVCNTFEKLIENKIIPIVNENDTVSIDEIENIVKFGDNDNLSAIVATLVKADLLIILSD
IDGFYDSDPRSNKDAKLLKVVEEITPELESCAGGAGSNLGTGGMVTKLAAAKKAVSSSVD
MILANGSDPSVILNVLDGEDVGTLFLGKK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggctttcgtaaaaatttaattaatgcaaatagaatagttgtaaaggtaggaacttca
acattaacctatgataatggtaatattaacttaagaagaattgaaagattaactcgagtt
ttatctgatattgttaattcaggaaaagaggttgttttagtaacatcaggagcaataggt
gttggtgtaagtaaattaaagttaaaagaaaagccccaaaatataagagaaaaacaagca
gttgcatcagtaggacaatgtgaacttatgcatatatatagtaaattctttggtgaatat
agtcacgttgttggtcaagttttacttacaagagatgtagtagaagatgatcatatcaga
gaaaacgtatgtaatacatttgaaaaattaatagaaaataaaataattccaatagttaat
gaaaatgatacagtttcaatagatgagatagagaatattgttaagtttggggacaatgat
aacttatcagctatagttgcaacattagtaaaagctgatttattaataatattatctgat
atagatggattttatgattctgatccaagaagcaataaggacgcaaaattattaaaagtt
gtagaagaaataacaccagaattagaaagttgcgctggaggtgctggttcaaatttagga
actggcggaatggtaacaaaacttgcagcagctaaaaaagcagtatcttcaagtgtagat
atgatcttagctaatggaagtgatccaagtgtaatattaaatgttttagatggtgaagat
gtgggaactttatttttaggcaaaaaataa

DBGET integrated database retrieval system