KEGG   Clostridium botulinum B Eklund 17B: CLL_A0469Help
Entry
CLL_A0469         CDS       T00696                                 

Definition
cyanophycinase (EC:3.-.-.-)
Orthology
K13282  
cyanophycinase [EC:3.4.15.6]
Organism
cbk  Clostridium botulinum B Eklund 17B
Brite
Enzymes [BR:cbk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.6  cyanophycinase
     CLL_A0469
Peptidases [BR:cbk01002]
 Serine Peptidases
  Family S51
   CLL_A0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469351..470196
Genome map
AA seq 281 aa AA seqDB search
MNENLNGNLIIIGGGEDKEGKKEILKRVCASIDKDKDILLIATIATEYPKEAANKYKRAF
GELKVKNIRVLDISERMDSFNEENVELIKNSSLIFFTGGDQLRITSLIGGSPIYSALKEA
CEKGIFIVGTSAGASVMSDTMIVEGSDEQSPRKCTLKMAPGLGLIKDVIIDQHFAQRGRI
GRLLTGIAENPEVLGIGIDENTAIIVNQEGKVEVIGAGAVYFIDGSKITYTNVSELYGED
ILSMYNVKLHILTNGKKFDLIKKLPFEEDKLSNESSTGKDI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgaaaatttaaatggaaatctgataataatcggaggaggagaagacaaagaaggg
aagaaagaaattttaaaaagagtatgcgcttcaatagataaagataaggatattttatta
attgcaaccattgcaacagagtatccaaaagaagcagcgaataagtataaaagagctttt
ggggaattaaaagttaaaaatataagagtattagatattagtgaaagaatggattctttt
aatgaggaaaatgtagagcttataaaaaattcatctttaatattttttacaggtggagat
caattaagaataactagcttaattgggggaagtcctatatattcagctttaaaggaagca
tgcgaaaaaggaatatttattgtaggaacatcagctggagcatcagttatgagtgatacc
atgatagttgaaggttcagatgaacaatctccaagaaaatgtactttaaaaatggcaccc
ggtctaggacttataaaagatgttataatcgatcagcactttgctcaaagaggaagaatt
ggtaggttattaactggtatcgcagaaaatccagaagtattaggtataggaatagatgaa
aatacagcaataatagttaatcaagaaggaaaagtagaagtaataggtgcaggtgctgta
tattttattgatggaagcaaaatcacatatacaaatgtttcagaactttatggagaagac
attctaagtatgtataatgttaaattacatattttaactaatggcaaaaaattcgatctt
ataaaaaagttaccttttgaggaggataaattaagtaatgaaagtagtacaggaaaggat
atatga

DBGET integrated database retrieval system