KEGG   Clostridium botulinum B Eklund 17B: CLL_A0769Help
Entry
CLL_A0769         CDS       T00696                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLL_A0769
   01230 Biosynthesis of amino acids
    CLL_A0769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A0769
   00030 Pentose phosphate pathway
    CLL_A0769
   00051 Fructose and mannose metabolism
    CLL_A0769
   00052 Galactose metabolism
    CLL_A0769
  Energy metabolism
   00680 Methane metabolism
    CLL_A0769
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLL_A0769
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLL_A0769
Protein phosphatases and associated proteins [BR:cbk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLL_A0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(781461..782678)
Genome map
AA seq 405 aa AA seqDB search
MSNCIIAQSGGPTSVINSSVVGLIHANKSLKVFNKVYGGLNGIEGILNKNIIDLTLINDD
ELQTFRYTPSSGLGSCRYKLQNPNNSCDEYEKLVEILKEYDITSFFYIGGNDSMDTIAKL
SAYSKKNNIDINFIGIPKTIDNDLMFTDHTPGFGSAAKFITTSVLETYLDSSVYINNGIF
ILETMGRDTGWLAASACIAKIDDKPVADFIYLPETAFDKYQFINDVRQKFKEQNKVYIVV
SEGIKDETGKFISEFQCVSNDNFGHAQLGGVSQYLRNLLLDAGITKRVKALELGILQRCA
MHFASDSDLNEAYDVGYVALQSALNNESGKMVAIKRADSKDYKSSYFLVDADKVANNVRY
FPSEWINEDGNFLKEEACEYFLPLVKNIPNLKLENNLPQYKVFNV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctaattgtattattgcacaatctggtggtccaacttctgttattaattctagtgta
gtaggattaatacatgctaataagtcacttaaagtttttaataaagtctatggtggttta
aatggtattgaaggaattttgaataagaatataattgatcttaccctaattaatgatgat
gagttacaaacttttagatacacaccatcttctgggttaggatcttgtagatataaatta
caaaatcccaataattcttgtgatgaatatgaaaaactagtagaaatattaaaagaatat
gatataacttcatttttttatataggtggaaatgattctatggatacaattgctaaactt
tctgcttattctaaaaaaaataatattgatataaactttattggtattcctaaaacaatt
gataatgatttaatgtttactgatcatacccctggttttggtagtgctgcaaaattcatt
acaacatcagtattagaaacttatcttgactcttctgtatatattaacaatggtattttt
atattggaaacaatgggccgagatacaggttggctagcagcctcagcttgcatagctaaa
atagatgacaaacctgttgctgattttatttacttgcccgaaacggcttttgataaatat
caatttatcaatgatgttagacaaaagtttaaagaacaaaacaaagtatatattgttgta
tctgaaggcattaaagatgaaactggtaaatttatatctgagtttcaatgtgtttctaat
gataattttggacatgctcaattaggtggtgttagccagtatctaagaaatttacttctc
gatgccggtataactaaaagagtaaaagctttagaacttggaattttacagcgttgtgcc
atgcactttgcatctgattctgatttaaatgaagcttatgatgttggttatgtagcttta
caaagtgcattaaataatgaaagtggtaaaatggttgctataaaacgtgctgattctaaa
gactataaatcatcttacttcttagtagatgctgataaagtagctaataatgttaggtac
ttcccttctgaatggattaatgaagatggaaacttcttaaaagaagaggcttgtgaatac
tttttaccattagtaaaaaatattcctaatttaaaattagaaaataatttaccacaatat
aaagtttttaacgtctaa

DBGET integrated database retrieval system