KEGG   Clostridium botulinum B Eklund 17B: CLL_A0798Help
Entry
CLL_A0798         CDS       T00696                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cbk02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cbk02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817369..818502
Genome map
AA seq 377 aa AA seqDB search
MWNYKEVNTLSKIKVIVVDDSAFMRKMISEIIEEDNEIEVVAKLRNGKELIEKVDKFNPD
IITLDLEMPEMDGLETLKELHKKNKNYSIMMLSSLTIKGSEKTMECLENGAIDFITKPSG
SISLDIRKVQENLIEKIKSISKRGIRTRVSNKSIDVSKTTIKSNNIYNDTKVKELKKSEN
INMITIKNKKIDAIVIGASTGGPKALQQLLTKFEANIGVPIFVVQHMPQGFTKAFSERLN
KICNLKVLEGEEGLKIEKNVIYIAKGGYHMTVGTDGRIHLNEEDPIWGVRPAVDKLFDSA
IKAYRGNLISVVLTGMGRDGARGTSNVKDYGGVTISEDESTCTIYGMPKAAFETGKVDLV
LPLNNICDEVTKIVKKR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgtggaattataaagaggtgaatacattgagtaaaataaaagttatagttgttgatgac
tctgctttcatgagaaaaatgatatcagaaataatagaagaagataatgaaatagaagta
gtagctaaattaagaaacggaaaagaacttattgaaaaggttgataagtttaatccagat
attataacgttggatttagaaatgccagaaatggatggattagaaacattaaaagagtta
cataaaaagaacaagaattattctataatgatgttaagtagtttaacaataaaaggttca
gaaaaaacaatggaatgtttagaaaatggagcgattgattttattactaaaccatcagga
agtatatctttagatataagaaaagttcaagaaaaccttattgaaaaaattaaaagtata
tctaaaagaggtataagaactagagtaagcaataaatcaatagatgtttctaaaactaca
ataaaaagcaataatatatataacgatacaaaagtaaaagaattgaaaaaatctgagaat
ataaatatgattacaataaaaaataaaaaaattgatgccattgttattggtgcatccact
ggtggtcctaaggcacttcaacaattattaactaaatttgaagcaaatattggagtacca
atatttgttgtgcaacatatgccacaaggatttacaaaagccttttctgaaagattaaat
aagatttgtaatcttaaagttttagagggtgaagaaggcttaaaaatagagaaaaatgta
atatatattgccaaaggtggttatcatatgactgttggtacagatggcagaattcatctt
aatgaggaagatccaatatggggagttagaccagctgtagataaactttttgattcggct
ataaaagcatacagagggaacttaatatctgtagttttaacaggtatgggtagagacgga
gctagagggacaagcaatgtaaaagactatggtggagttacaatatcagaagatgaatca
acgtgtactatttatggtatgcctaaagctgcatttgaaacaggtaaagtagatttagtc
ttaccacttaataatatatgtgatgaagtaactaaaattgtaaaaaaacgttag

DBGET integrated database retrieval system