KEGG   Clostridium botulinum B Eklund 17B: CLL_A0798Help
Entry
CLL_A0798         CDS       T00696                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLL_A0798
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    CLL_A0798
Enzymes [BR:cbk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     CLL_A0798
Two-component system [BR:cbk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   CLL_A0798
Bacterial motility proteins [BR:cbk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    CLL_A0798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
817369..818502
Genome map
AA seq 377 aa AA seqDB search
MWNYKEVNTLSKIKVIVVDDSAFMRKMISEIIEEDNEIEVVAKLRNGKELIEKVDKFNPD
IITLDLEMPEMDGLETLKELHKKNKNYSIMMLSSLTIKGSEKTMECLENGAIDFITKPSG
SISLDIRKVQENLIEKIKSISKRGIRTRVSNKSIDVSKTTIKSNNIYNDTKVKELKKSEN
INMITIKNKKIDAIVIGASTGGPKALQQLLTKFEANIGVPIFVVQHMPQGFTKAFSERLN
KICNLKVLEGEEGLKIEKNVIYIAKGGYHMTVGTDGRIHLNEEDPIWGVRPAVDKLFDSA
IKAYRGNLISVVLTGMGRDGARGTSNVKDYGGVTISEDESTCTIYGMPKAAFETGKVDLV
LPLNNICDEVTKIVKKR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgtggaattataaagaggtgaatacattgagtaaaataaaagttatagttgttgatgac
tctgctttcatgagaaaaatgatatcagaaataatagaagaagataatgaaatagaagta
gtagctaaattaagaaacggaaaagaacttattgaaaaggttgataagtttaatccagat
attataacgttggatttagaaatgccagaaatggatggattagaaacattaaaagagtta
cataaaaagaacaagaattattctataatgatgttaagtagtttaacaataaaaggttca
gaaaaaacaatggaatgtttagaaaatggagcgattgattttattactaaaccatcagga
agtatatctttagatataagaaaagttcaagaaaaccttattgaaaaaattaaaagtata
tctaaaagaggtataagaactagagtaagcaataaatcaatagatgtttctaaaactaca
ataaaaagcaataatatatataacgatacaaaagtaaaagaattgaaaaaatctgagaat
ataaatatgattacaataaaaaataaaaaaattgatgccattgttattggtgcatccact
ggtggtcctaaggcacttcaacaattattaactaaatttgaagcaaatattggagtacca
atatttgttgtgcaacatatgccacaaggatttacaaaagccttttctgaaagattaaat
aagatttgtaatcttaaagttttagagggtgaagaaggcttaaaaatagagaaaaatgta
atatatattgccaaaggtggttatcatatgactgttggtacagatggcagaattcatctt
aatgaggaagatccaatatggggagttagaccagctgtagataaactttttgattcggct
ataaaagcatacagagggaacttaatatctgtagttttaacaggtatgggtagagacgga
gctagagggacaagcaatgtaaaagactatggtggagttacaatatcagaagatgaatca
acgtgtactatttatggtatgcctaaagctgcatttgaaacaggtaaagtagatttagtc
ttaccacttaataatatatgtgatgaagtaactaaaattgtaaaaaaacgttag

DBGET integrated database retrieval system