KEGG   Clostridium botulinum B Eklund 17B: CLL_A0976Help
Entry
CLL_A0976         CDS       T00696                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLL_A0976 (malQ)
Enzymes [BR:cbk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CLL_A0976 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
981616..983103
Genome map
AA seq 495 aa AA seqDB search
MRRSSGIIMHIASLPGEFGIGTFGKEAYEFADFLKESHQKYWQILPIGPTSYGDSPYQSF
SAFAGNPYFIDFNLLKKDGLLKSKDYSNLNFGKDKEDIDYGLIFVEKMKVLRKAYERFKL
NLPTDLKEFEEENQWLNDYSLYMALKSKFELKSWQKWDIDIKLRKKEVLNKYKEELKDEI
NLWKFIQYKFFEQWTNLKKYVNDLDIEIIGDIPIYVAEDSADIWANPKAFLLDEETLVPL
KVSGCPPDNFAVTGQLWGNPIYNWDYIDKTNYKWWIDRMKQSSKLYDVIRIDHFRGFESY
WSIPYGDPTAENGEWVKGPGMKLFNAIKKELGDIKIIAEDLGFLTDEVVKFREESGFPGM
RVLQFAFVGDAANRDLPHNYEENCIAYTGTHDNNTFRGWLEKTGTEEEIEASIKYLGLNK
EEGYNWGFIRGVWSSKAYLSIALIQDFLNLGNESRINVPSTLGQNWRWRAKEDVFTDELA
EKIYEITKMYGRCEE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaagcagtggaattataatgcatattgcatctttaccaggggaatttggaata
ggaacatttgggaaagaggcatatgagttcgcagattttttgaaagaatcacatcaaaaa
tattggcaaatacttcctataggaccaactagttatggagattcaccatatcaatctttt
tcagcatttgcaggaaatccttattttatagattttaatttattaaaaaaagatggatta
ttaaaaagcaaagattattcaaatttgaactttggaaaagataaagaagatattgattat
ggattaatatttgtagaaaaaatgaaggttctaagaaaagcatatgagaggtttaaactt
aatttaccaacagatttaaaagaatttgaagaagaaaatcagtggttaaatgattattct
ttatatatggcacttaaatcaaaatttgaattaaagagttggcaaaaatgggatatagat
attaaacttagaaaaaaagaagttttaaataaatataaagaagaattaaaagatgaaata
aacctttggaaatttatacaatataagttttttgaacaatggaccaatttaaagaaatat
gtaaatgacttggatattgaaattataggagatattccaatatatgtagctgaagatagt
gcagatatatgggcaaatccaaaagcatttttattagatgaagaaacgttagtaccatta
aaagtttcaggatgtccaccagacaattttgctgtaacaggtcaattatggggaaatcca
atttataattgggactatattgataagactaattataaatggtggatagacagaatgaaa
caaagttcaaaattatatgatgttataagaatagatcattttagaggatttgaatcttat
tggtcaataccttatggggatcctacagcagaaaatggagaatgggtaaagggtccagga
atgaaattattcaatgcaataaagaaagagcttggagatataaaaataatagcagaagac
ttaggatttttaactgatgaagttgtaaaatttagagaagaatcaggatttccaggaatg
agagtacttcaatttgcatttgtaggagatgctgcaaatagagacctacctcataattat
gaagaaaattgtatagcttatacaggcactcatgataataatacatttagaggatggctt
gaaaaaacaggaactgaagaagaaattgaagcatctattaaatatctgggattaaataaa
gaagaaggatataactggggatttataagaggggtatggagtagtaaagcttatttatca
atagcgttaatacaagatttcttaaatttagggaatgaatctagaattaatgttccttca
acactaggacaaaattggcgttggagagctaaagaagatgtatttacagatgaactagca
gaaaaaatttatgagataacgaaaatgtatggaaggtgcgaagaataa

DBGET integrated database retrieval system