KEGG   Clostridium botulinum B Eklund 17B: CLL_A1022Help
Entry
CLL_A1022         CDS       T00696                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbk03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1038264..1038860
Genome map
AA seq 198 aa AA seqDB search
MYEYIKGEYMGINKDYIIIENNGIGYKIFTSGATMSSMPCCGEKIKLYIEQIVREDFIGL
YGFESLEELEMFKMLLSINGVGAKAALSLLSISRLNNLKYAIITGDEKHLCRGVGIGKKT
AARIILELKDKLKTDELLNCIDEFDDVTQDNSLAVSEALSALISLGYTEKEAEKVLRDVD
KSESVENIIKSALVKLMG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaatatataaaaggtgaatatatgggaataaacaaagattatatcattattgaa
aataatggaataggatataaaatatttacttcaggtgcaaccatgtcttcaatgccatgc
tgtggtgaaaaaataaaattgtatattgaacaaattgtaagagaagattttattggatta
tatggttttgaatctttagaagagttagaaatgtttaaaatgttactttcgataaatggt
gttggagctaaagcagctttgtcattattatctataagtcgtttaaataatttaaaatat
gcaataattactggagatgaaaaacatctttgtagaggtgttggtataggtaaaaagaca
gctgctaggattatattagaattaaaagataagttaaagacagatgaattactaaattgt
atagatgaatttgatgatgtaacacaagacaactcacttgctgtttcagaagcattaagt
gcattgatttctttaggatatacagaaaaagaagcagaaaaagtgcttagagacgtggat
aaatctgaaagtgttgaaaatattataaaaagtgcattagttaaactaatgggataa

DBGET integrated database retrieval system