KEGG   Clostridium botulinum B Eklund 17B: CLL_A1043Help
Entry
CLL_A1043         CDS       T00696                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLL_A1043 (glpK)
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CLL_A1043 (glpK)
Exosome [BR:cbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLL_A1043 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1061271..1062767
Genome map
AA seq 498 aa AA seqDB search
MGKYVVALDQGTTSSRAIIFDKEQNIVGVSQKEFTQIYPHEGWVEHNPLEIWSSQYGVLQ
EVLAKTNVTADEISAIGITNQRETTIVWDKNTGEPVYNAIVWQCRRTASIVDELKKDDEF
AEYVKANTGLLLDAYFSGTKIKWILDNVEGAREKAEKGDLLFGTVDTWLVWKLTNGKVHV
TDYTNASRTMLYNIKELRWDEKIINKLGIPTSMLPEVKNSSEVYGHTNLGGVGGVRVPIS
GMAGDQQCALFGQTCFEKGSAKNTYGTGCFLLMNTGEDMVLSKNGLVTTIAVGINDKIEY
ALEGSVFVGGAVIQWVRDELQFIHDAADSEYFAKKVEDNGGVYVVPAFVGLGAPYWDMYA
RGAIFGLTRGANRNHIIRAALESIAYQTNDLLTAMAEDAGCKLASLRVDGGASRNDLLMQ
FQADISNTQVLRPIITETTALGAAYLAGLAVGFWESKEEIATKWAISKSYGPTFERAKRE
KLNKGWKNAVSRVKGWAE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaatatgttgtagcgttagatcaaggaactacaagttcaagagctattattttc
gacaaagaacaaaatatagtaggtgtaagccaaaaagagtttacacaaatatatccacat
gaaggttgggtagaacataatccactagaaatttggtcaagtcaatatggagtgcttcaa
gaagtattagcaaagactaatgttactgctgatgaaatatcagctataggtataacaaat
caaagagaaactacaatagtatgggacaagaatacaggagaacctgtttacaatgctata
gtatggcaatgtagaagaactgctagtatagtagatgaattaaagaaagacgatgaattt
gctgaatatgtaaaagcaaatacaggattattattagatgcttacttctcaggaactaaa
atcaaatggattttagacaatgttgaaggtgcaagagaaaaagctgaaaaaggtgattta
ttatttggtacagtagatacatggttagtttggaagttaacaaatggtaaggtgcatgta
accgactacactaatgcttctagaactatgctatataatataaaagaattaagatgggat
gaaaaaataattaataaattaggaataccaacttctatgttaccagaagttaagaattct
tcagaagtttatggacatactaatcttggtggcgttggtggcgttagagttccaatatca
ggtatggctggagaccaacaatgtgcattatttggacaaacttgtttcgaaaaaggtagt
gctaaaaacacttacggaactggatgtttcttacttatgaacactggtgaagacatggtt
cttagtaaaaatggtcttgtaactacaattgctgttggtataaatgataaaattgaatat
gctttagaaggttcagtattcgtaggtggagctgtaattcaatgggtaagagatgaactt
caattcatccatgatgcagcagattcagaatactttgctaaaaaagtagaagacaatggt
ggagtttatgtagtaccagcattcgttggactaggagcaccatattgggatatgtatgct
agaggagctatctttggattaactagaggagctaatagaaatcatataatcagagcagca
ttagaatcaatagcttatcaaactaatgatttattaactgctatggcagaagatgctgga
tgtaaattagcatcacttagagttgatggtggagctagtagaaatgatttattaatgcaa
ttccaagctgatatttcaaatactcaagttcttagaccaataattactgaaactacagct
ttaggagctgcttacttagcaggtcttgcagttggattctgggaatctaaagaagaaatt
gcaactaaatgggctattagtaagagttatggaccaacttttgaaagagctaagagagaa
aagctaaacaaaggatggaaaaatgcagtttcaagagttaaaggttgggcagaatag

DBGET integrated database retrieval system