KEGG   Clostridium botulinum B Eklund 17B: CLL_A1211Help
Entry
CLL_A1211         CDS       T00696                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cbk00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240271..1240909
Genome map
AA seq 212 aa AA seqDB search
MIDKKRGLLIVISGPSGAGKGTICKELLEKNDNLLLSVSATTRSPRNGEIDGVNYHFLCK
EDFITRIEKNDFLEHAEVYGNYYGTPKSNVDKMLDSGRDVILEIDIQGALKVKENTEEGV
FIFILPPSMEELKQRIINRGSETPESLMKRFKSAYKEINFVSKYNYAVVNDEVDIAVEKL
EAIILAEKCRVDRLKHSILDSKEDLIHEQLYD
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattgataaaaaaagaggtttactaattgttatatcgggaccatcaggtgcaggtaaa
ggtacgatctgcaaagaattacttgaaaaaaatgataatttattattatcagtttcagca
acaactagatccccaagaaatggtgaaatagatggtgttaattatcattttttatgtaaa
gaagattttataacaagaatagaaaaaaatgattttttagaacatgcagaagtatatgga
aactattatggaacacctaaatccaatgtggataaaatgttagacagtggtagagatgtc
attttagaaatagatatacaaggcgcattgaaagtaaaagaaaatacagaagaaggtgta
tttatatttatattaccaccttctatggaagagttaaaacaaagaattattaatagggga
agtgaaaccccagaatctcttatgaagagattcaaatctgcctataaagaaataaatttt
gtttctaagtacaattatgcagtagttaatgatgaagttgacattgcagtagaaaaatta
gaagcaataatattagctgaaaaatgtagggtagatagattaaaacacagtatattagat
tcaaaggaggacttaatacatgaacaactctatgattaa

DBGET integrated database retrieval system