KEGG   Clostridium botulinum B Eklund 17B: CLL_A1445Help
Entry
CLL_A1445         CDS       T00696                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cbk00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cbk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1494778..1496394
Genome map
AA seq 538 aa AA seqDB search
MNSTANKHWKLIATMMLILIVVSISIEMILKENNESKAIFAAENSDNDIIPKPLSYKIGD
GNFIITKDTSIYVKGNTKEETEEISKIAEFIRGKLKASTGFELNIIQGKEGKSGSIYLTT
IGAEESQGNEGYEIVTTNKNVKIIAYKAEGISRGVQTLRQLLPPDIEKNTIATDVDWNIP
VSIINDKPEYNYRGLMIDVVRHFFTIDEVKRQIDYAAQYKINRVHLHLSDDQGWRLEIKK
YPDLTIIGGSTEVGGGKGGYYTQEEFKDLVKYAAERYVEIIPELDMPGHSNAALASYGFL
NKDGEKKPLYTGTEVGFSSLMTHNEETYEFIDNVIKEVSEISPSKYIHIGGDEADSTKKS
DYDYFVGRVSKIIEKYGKTPIGWDPIDISPEINSSVILQNWKDSNEAARKKEMKMIISIA
QKAYLDMKYNESTPYGLTWAGYIPVETAYKWDPTDYAPKELVLGIEAPLWTETISDAKAM
DYMIYPRLLGYAEIGWTPKENRDWSQYKNRLEKQGKRMKNQGINYYKDSRIWGESNTQ
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtacagctaataagcattggaagttgatagcgacaatgatgttaatactaata
gtagtgagtatttctattgaaatgattcttaaagaaaataatgaatcaaaagcaattttt
gcagcagaaaatagtgataatgatattattccaaagcctctaagttataaaattggtgat
ggtaattttataattacaaaagatacttcaatttatgtaaaaggaaatactaaagaagaa
acagaagaaattagtaaaattgcagagtttataagaggaaaattgaaggcttcaactgga
tttgaattaaatattattcaaggaaaagaaggcaaatcaggtagtatatatttaactact
ataggggcagaggaaagtcaaggtaatgaaggttatgaaatagtaactacaaataaaaat
gttaaaattatagcgtataaggcagaaggtatttcaagaggagttcaaacattaagacag
ttattaccaccagacattgaaaaaaatactatagctactgatgtagactggaacatccca
gtttcaataataaacgacaaacctgaatataattacagaggattaatgattgatgtggtt
aggcacttttttactatagatgaagttaaacgtcagatagattatgcagctcaatataaa
ataaatagagttcatttacatcttagtgatgatcaaggatggcgtttagaaataaaaaaa
tatcctgacttaactataataggtggaagtacagaagttggcggaggaaaaggaggatat
tatacacaagaagaatttaaagatttagttaaatatgcagcagaaagatatgtggaaata
attcctgagttggatatgccaggtcatagtaatgctgcactagcttcttatggattttta
aataaagatggtgaaaagaaacctttatatacagggactgaggtgggttttagttctctt
atgacccataatgaagagacatatgaatttattgataatgtaattaaagaagtatcggaa
atatctccttcaaaatatattcatataggaggagatgaagcagatagtactaaaaagtca
gattatgattattttgtaggaagagtgtctaaaataattgaaaaatatggaaaaactcca
ataggttgggatcctattgatatatctccagaaataaactcaagtgtaatattacaaaat
tggaaagattcaaatgaagcagctagaaaaaaagaaatgaaaatgattatttcaattgca
caaaaagcttatttagatatgaaatataatgaaagtacaccatatggattaacatgggca
ggttacattcctgtagaaactgcatataaatgggaccctactgattatgctccaaaggaa
ttagttttaggcatagaagcaccactgtggacagaaacaatttctgatgcaaaagctatg
gactatatgatatatccaaggttgctaggttatgctgaaataggatggacaccaaaagaa
aatagagattggagtcagtataagaacagattagagaaacaggggaaaagaatgaaaaat
caaggaataaattactataaagatagtagaatatggggagagtctaatactcaataa

DBGET integrated database retrieval system