KEGG   Clostridium botulinum B Eklund 17B: CLL_A1465Help
Entry
CLL_A1465         CDS       T00696                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLL_A1465
   00650 Butanoate metabolism
    CLL_A1465
Enzymes [BR:cbk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLL_A1465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513293..1514852
Genome map
AA seq 519 aa AA seqDB search
MENFDRDLCSIQEARNLARLGKVAAEKIADYTEEQIDKILCNMVKVAEANAVCLAQMAVE
ETGFGKVEDKTYKNHMASTILYDSIKDMKTIGVIKEDEANKLIELAEPVGLVMGIVPSTN
PTSTAIFKAIIAIKSRNAIVFSPHPSAAQCTIKAAKLMNEAAIEAGAPENIIGCVSTPTI
GATNELMKSKEVAIIIATGGPGMVKAAYSSGKPALGVGAGNSPAYIERSANVEKAIRNII
ASKTFDNGTICASEQSIICEECNHDEVVAELKKQGGYFMTAEETDKVCKLLFKNGHSMNA
KFVGRSPQVIASSAGISIPQDTKVLIGEQKGVGEGYPLSFEKLTTVLAFYTVKDWHEACE
LSIELLQNGIGHTMSIHTEDRDIVMKFARKPASRILVNTGGSQGGTGASTGLIPSFTLGC
GTWGGSSVSENVTPMHLINIKRVAYGLKDCATLASNDPTFNRIKTENNCHHTQNQCGSLS
PDQYAAASKCINTDDIKNANNEELLDMINKLVKVMKGEA
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggagaattttgatagagatttgtgttcaatacaagaagcaagaaatcttgctcgctta
ggaaaagttgcggcagaaaaaattgctgattatactgaagaacaaattgataaaatttta
tgcaacatggttaaggttgcagaagcaaatgctgtttgcttagcacaaatggcagtagaa
gaaactggttttggtaaggttgaagataaaacttataagaatcatatggcatctactata
ttatatgattcaattaaagatatgaaaactattggtgttatcaaagaagatgaggctaat
aagttaatagaacttgctgaacctgttggattagtaatgggaatagtaccttcaacaaat
ccaacgtctacagctatttttaaagcaataattgctataaaatctcgtaacgcaatagta
ttttcaccacatccatcagcagcacaatgtacaataaaagcagctaaattgatgaatgag
gcagctatagaagctggagctccagaaaacattattggttgtgtttctactccaacaatc
ggagctacaaatgaattaatgaagagtaaagaagttgctataataatagcaacaggtggt
ccaggaatggtaaaagctgcttatagttcaggaaaaccagcacttggagtaggagcagga
aactctccagcatatatagaaagaagtgcaaatgttgaaaaagctataagaaatattatt
gcaagtaaaacatttgataatggtacaatctgtgcatcagaacaatctattatatgtgaa
gaatgtaatcatgatgaagtagttgcagaattaaagaaacaaggcggatatttcatgaca
gcagaagaaacagataaagtttgtaaactgttgtttaagaatgggcatagcatgaatgct
aaatttgtaggtagatctccacaagttatagcgagttcagcaggaatttctattccacaa
gatacaaaggtacttataggagaacaaaagggtgttggtgaaggttatccattatctttt
gaaaaacttacaacagtacttgcattctatacagtaaaggattggcatgaagcatgtgaa
ttaagtattgaattacttcaaaatggaataggccatacaatgagtattcatactgaagat
agagatatagtaatgaaattcgctagaaagccagcatcacgtattttagttaatactggt
ggtagccaaggtggaacaggtgcaagtacaggacttataccatcatttacactaggctgt
ggtacttggggaggtagttcagtttctgaaaatgttaccccaatgcacttgattaacatc
aagagagttgcttatggtttaaaggattgtgcaacattagcttctaatgatccaactttt
aatcgcattaaaacagaaaataattgtcaccatacacaaaatcaatgtggaagcttgagt
cctgatcagtatgcagctgcatcaaagtgcatcaatactgatgatattaaaaatgctaac
aatgaagaacttttggatatgattaataagttagttaaggtgatgaagggggaagcatag

DBGET integrated database retrieval system