KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A1973Help
Entry
CLL_A1973         CDS       T00696                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLL_A1973 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLL_A1973 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLL_A1973 (trpB)
Enzymes [BR:cbk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLL_A1973 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2051175..2052392)
Genome map
AA seq 405 aa AA seqDB search
MDFRTYLKKYPDKNGRFGQYGGAYLTAELIPAFEEIADAYQTICHSSQFINELRRIRKEF
QGRPTPVYHCERLSRAIGNCQIYLKREDLNHTGAHKLNHCMGEGLLAKFMGKKRLIAETG
AGQHGVALATAAAFFGLECEIHMGEVDIAKQAPNVTRMKILGAKVVPVTHGLKTLKEAVD
SAFDSYAKNYKDSIYCIGSALGPHPFPLMVRDFQAVVGYEAKDQFKEMTGFLPDVVTACV
GGGSNAAGMFIPFLEEPVDIIGIEPLGRGEKLGDHAASMKYGEKGVMHGFESIMLKDKNG
DPAPVYSIASGLDYPSVGPEHAFLRELGRVDYKVINDEEAMEAFFKLSRYEGIIPAIESS
HAVAYAMKKAEEMKQGSILVCLSGRGDKDIDYIVEHYGYGEQYFK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggattttcgaacatatttaaagaagtatccagataaaaatggtcgctttggtcaatac
ggtggggcatacttaacagctgagctaattccagcttttgaggagattgctgatgcatat
caaacgatttgtcattcttcacagtttattaatgaacttagaagaatccgtaaagaattt
caaggtagacctacaccagtttatcattgcgaaagactatctagagcaataggaaattgt
caaatttatttaaaaagagaagatttaaatcatacaggggcacacaaattaaatcattgt
atgggtgaaggattacttgctaaatttatgggaaaaaagcgtttgattgcagaaacagga
gcaggacaacatggtgtggcgcttgcaacagctgctgcattttttggattggaatgtgaa
attcatatgggagaagttgatattgcaaagcaagcgccaaatgtaactaggatgaaaata
ttaggagctaaagttgttccagtaacacatggtttaaaaactttaaaagaagctgtggat
tctgcttttgattcatatgctaaaaattataaggattcaatttactgcataggatcagcc
ttaggtccgcatccatttccacttatggtaagagatttccaagctgttgttggttatgaa
gctaaagatcaatttaaggaaatgacaggttttttaccagatgtagttactgcttgtgta
ggcggtggaagcaatgctgctggaatgtttataccttttttagaggaaccagttgatata
attggaatagaaccattaggtagaggcgaaaaattaggagatcatgctgcatctatgaaa
tatggagaaaaaggtgttatgcatggctttgaaagtataatgttaaaagataaaaatggt
gatccagcaccagtatattctatagccagtggacttgattatccatcagttggtcctgaa
catgcatttttaagagaattaggacgtgtagattataaagttataaatgatgaagaggca
atggaagctttctttaaattatcaagatatgaaggaattatacctgcaattgaaagttca
catgctgttgcatatgcaatgaaaaaagctgaagaaatgaaacaaggatctattttagtt
tgtttgagtggacgtggtgataaagacattgattatattgttgaacattatggatatgga
gaacaatattttaaataa

DBGET integrated database retrieval system