KEGG   Clostridium botulinum B Eklund 17B: CLL_A2124Help
Entry
CLL_A2124         CDS       T00696                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cbk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2220811..2222499)
Genome map
AA seq 562 aa AA seqDB search
MNRVELINSVIDKIKFIYGENYKEEYKGEFDKLVSKWENEEFDKADEVSEKNVYLITYGD
SIYEEGIPTIQTLNKFLKEEVKDTITDVHILPMFTYTSDDGFSVVDYMEIDKNLGNWEDI
NTLSKDYRLMYDFVANHISKSSSWFKGYLNNEKKYAEYFIKEDKSFDTKNVVRPRTSSLF
HEYEGKDGIKTAWTTFSEDQIDVNIKHFPLFIEMTDILLNYAKNGATSIRLDAIGFLWKE
SGTNCMHLPETHKIIEIWRLLLDYFKKNTQIITETNVPHVENISYFGNKINEAHMVYQFT
LPPLVLYTLTTHNARKLTDWAKTIDRVSENATYFNFLSSHDGIGMRPTEGILTEGEKQVL
VDKVVENGGRASYKNNTDGTKSVYELNINYNDALINKNEDISTEAQVDKIIASNAILLSC
VGVPAIYYHSLLGSRNDYKGLEESGINRRINREKLEYTKILKELEVDERRNAIFSRIKKL
IALRKEESAFSPFAMQKVLDLGESIFALERFNEKTGEKITLILNVDSKEANVYCNIKGVD
KVTGRKIDGNITLKPYEFVWIK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagtagagttaattaactcagttatagataaaataaaatttatttatggtgaa
aactataaagaagaatataaaggggaatttgataaattagtaagcaagtgggaaaatgaa
gagtttgataaggctgatgaagtgtcagaaaaaaatgtttatttaattacttatggggat
tcaatttatgaagagggtatacctacaatacaaactttaaataagtttttaaaggaagag
gtaaaggacacaattacagatgttcatatacttccaatgtttacttacacttcagatgat
ggattttcagtagttgattatatggagatagataaaaatcttggaaattgggaagatata
aatactttatcaaaggattacagattaatgtatgattttgttgcaaaccatatatcaaaa
agcagtagctggtttaaaggttatttaaataatgaaaaaaaatatgcagagtattttata
aaggaagataaaagttttgatactaaaaatgttgttagaccaagaacatcatctttattt
catgaatatgaaggtaaagatggaatcaaaactgcttggacaacattcagtgaggatcaa
atagatgttaatataaaacattttccattgtttattgaaatgacggatattttattaaac
tatgctaaaaatggagcaacatcaataagattagatgctataggattcttatggaaagaa
tcaggcacaaattgtatgcatttacccgaaactcataagattatagaaatatggagatta
ttattagattacttcaagaaaaatactcaaataatcacagaaactaatgtgccacatgtt
gaaaatataagttactttggaaataaaatcaatgaagcccacatggtttatcaatttaca
ttacctccattagtgctttatacactaactactcataatgcaagaaagcttactgactgg
gcaaaaactatagatagggtttcagaaaatgctacatactttaactttttatcaagccat
gatggaataggtatgaggccaacagaaggcattcttactgaaggtgaaaagcaagtttta
gttgacaaagtagttgaaaatggtggaagagcttcatataagaacaatacagatgggaca
aaatcagtatatgaattaaacataaattacaatgatgctcttattaacaaaaatgaagat
atatctactgaagcacaagtagataaaattatagcttctaatgcaattcttttaagttgt
gttggtgtaccagctatttattatcattcattattaggttcaagaaatgattataaagga
ttagaagaatcaggaataaacagaagaatcaatagagaaaaattagagtacactaaaatt
ttaaaagagttagaagtagatgaaagaagaaatgccatattctctagaattaaaaaatta
attgctttaagaaaagaagaatcagcattctcaccatttgcaatgcaaaaagttttagac
ttaggtgaaagtatatttgcattagaaagatttaacgaaaaaacaggtgaaaagattact
ttaattttaaatgttgacagtaaagaagctaatgtttattgtaatattaaaggcgtagat
aaagttacaggacgaaaaatagatggtaatattactttaaaaccttatgaatttgtatgg
ataaaatag

DBGET integrated database retrieval system