KEGG   Clostridium botulinum B Eklund 17B: CLL_A2297Help
Entry
CLL_A2297         CDS       T00696                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbk00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2366948..2367850)
Genome map
AA seq 300 aa AA seqDB search
MINTITLNPSLDYIVKVDNFKVDSLNRSNDEEVYAGGKGINVSIVLNNLGIDNTALGYVA
GFTGNEIERQVKNHGVDCDFIKLKNGISRINVKLKSDGETEINGAGPKITNDDLNKLYEK
LSDLKEGDYLILSGSIPNSVPDDIYQNIMEKLLEKKVEFIVDATKDLLLKVLKYEPFLIK
PNHHELAEMFNVELKNDEDIITYGKKLQEMGAKNVLISMAGDGAILLSENGETIKREVPK
GILKNSVGAGDSMVAGFLAGYLKNNDIKEAFKMGIATGSASAFSDELATKEEVEKLLSKM
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgattaatacaataactcttaatccttcattggattatatagtaaaagttgataatttt
aaagttgattcattaaatagaagtaatgatgaagaagtttatgcaggaggaaaaggaata
aatgtttctatagtcttaaataatttaggcatagataacacggcattagggtatgttgca
ggttttacaggaaatgaaatagaaagacaagtgaaaaatcatggtgttgactgtgacttt
ataaaattaaaaaatggcatatcacggattaatgtaaaattaaaaagtgatggagaaaca
gaaataaatggagcaggtcccaaaattacaaatgatgatttaaataaattatatgaaaaa
ctttctgacttaaaagaaggagactatttaatattgtcaggtagtattccaaatagtgta
ccagatgatatttatcaaaatataatggaaaaacttttagaaaagaaggtagaatttata
gttgatgcaacaaaagatttactgttaaaggtactaaagtacgagccatttctaataaaa
cctaatcatcatgaattagctgaaatgtttaatgttgagctgaaaaatgatgaagatata
ataacttatggtaagaagcttcaagaaatgggagcaaagaatgtattaatttcaatggct
ggagatggagcaattttattatctgaaaatggagaaactataaaaagagaagtaccaaag
ggaatattaaaaaactcagtaggagccggagattctatggtggcaggttttttagcagga
tatcttaaaaataatgatataaaagaagcatttaaaatgggaattgcaacaggtagtgca
agtgcattttctgatgaattagcaacaaaagaagaagttgaaaaactattatctaaaatg
taa

DBGET integrated database retrieval system