KEGG   Clostridium botulinum B Eklund 17B: CLL_A2445Help
Entry
CLL_A2445         CDS       T00696                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cbk00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cbk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2527821..2529275)
Genome map
AA seq 484 aa AA seqDB search
MNLKDILKGIDYKLVQGSLDKEISSINYDSRKVNKSDIFICIKGYATDGHKYIQKAIENG
ASVIIMQDDIEVVNKNISVIKVKDTRKALALIGINYYDNPSKKMKIIGITGTNGKTTTAF
MIKSILESNGKKVGLIGTIANYIGNEKLHTERTTPESLELQELFNNMVNKGVEYCVMEVS
SHSLELDRVYGVDFEVGIFTNLTRDHLDFHKTFENYYNSKFKLFKRSNIRIINNDDNYGK
QVIKDLNKLKAKNIYEYSIKEDSNFKAFDEKMGSKNISFKVNLEKEEEFILSIPGEYNIY
NALGAIGACYKLNIPMEAIKNGINKVIVPGRCERTATNYNLPYDIIIDYAHTPDGLQNIL
ETARGFTQGRLIAIFGCGGDRDKVKRPQMGKIGTDIADIAIVTSDNPRSEEPMRIIEDIL
VGIEKDNYEIIENRKDAIKKAMDIAKENDVIVIAGKGHETYQILKDKTIHFDEREVVKQI
LDDK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttaaagatattttaaagggaatagactataagcttgtacaaggaagcttagat
aaagaaatatcttcaattaattatgatagtagaaaggttaataagtcagatatttttatc
tgtataaaagggtatgctactgatgggcataaatatattcaaaaggcaattgaaaatggc
gcctctgttattataatgcaagatgatattgaagtagtaaataaaaatatatctgttatt
aaagtaaaggatactagaaaagcgttagctcttataggaataaattattacgataatcca
agtaaaaaaatgaagattattggtataacaggcactaatggcaaaacgacaactgcattt
atgatcaaatcaattctagaatccaatggtaaaaaggtaggacttataggaactatagct
aattacattggaaatgaaaaacttcatacagaaagaactacacctgaatcattagaatta
caagaattgttcaataatatggttaataagggtgtagaatactgcgttatggaagtatct
tctcattctcttgaattagatagagtatatggagttgactttgaggttggaatttttacg
aatttaacgagagatcatttagatttccataaaacttttgaaaattattacaattctaaa
tttaaattatttaagagaagtaatataagaataattaataatgatgacaattatggaaag
caagtaattaaagatttaaataaactgaaagcaaaaaatatatatgaatattctataaag
gaagactctaattttaaagcatttgatgaaaaaatgggaagtaaaaacataagttttaaa
gttaatttagaaaaagaggaagaatttattttatcaataccaggcgagtacaatatatat
aatgccttaggtgctataggagcatgctataagttaaatataccaatggaagctataaaa
aacggaattaacaaagttatagttccaggtagatgtgaaagaacagctactaattacaat
ttaccttatgacataataatagattatgctcatactccagatggattacaaaacatctta
gaaactgcaagaggatttacgcaaggaagattaattgccatctttggatgtggaggggat
agagataaggtaaagcgtcctcaaatgggtaaaataggaactgatatagcagatatagct
atagtaacttcagataacccaagaagcgaagagcctatgagaataatagaggatatacta
gtaggaatagaaaaagataattatgaaattatagaaaatagaaaagatgctataaaaaaa
gcaatggatatagccaaagaaaatgatgtaatagttatagctggtaaaggacatgaaaca
tatcaaattttaaaagacaaaacaatacattttgatgaaagagaagttgttaaacaaata
ttagatgataaataa

DBGET integrated database retrieval system