KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A2533Help
Entry
CLL_A2533         CDS       T00696                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00010  Glycolysis / Gluconeogenesis
cbk00030  Pentose phosphate pathway
cbk00051  Fructose and mannose metabolism
cbk00680  Methane metabolism
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01120  Microbial metabolism in diverse environments
cbk01130  Biosynthesis of antibiotics
cbk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A2533 (fbp)
   00030 Pentose phosphate pathway
    CLL_A2533 (fbp)
   00051 Fructose and mannose metabolism
    CLL_A2533 (fbp)
  Energy metabolism
   00680 Methane metabolism
    CLL_A2533 (fbp)
Enzymes [BR:cbk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CLL_A2533 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Terminase_3
Motif
Other DBs
NCBI-ProteinID: ACD23440
UniProt: B2TNB5
Position
complement(2640585..2642576)
Genome map
AA seq 663 aa AA seqDB search
MEVKMNKNEQEDSKKLKYFRLLAKQYPNIALASTEIINLEAILNLPKGTEHFLSDIHGEY
EPFVHVLRNGSGVVKRKIEDLFCKSLLESDIKSLATLIYYPEQKLDIVLKEERNIDDWYK
ITLNRLIEICRFCSSKYTRSKVRKALPADFAYIIEELLHEQFNGIDKEEYYDRIITTIID
IGRAKEFIIALSKLIQRMIIDRLHIIGDIYDRGPRPDIIIDTLMEYHSVDIQWGNHDMLW
MGAAAGVRTCVANVLRISTRYANLDLVEEIYGINLLPLATFALKYYRDDPCESFIPKVKE
DDPAASQEVDLVSKMHKAITILQFKLEKEIIDRRPEFELEGRLLLDKIDYEKGTIILNGI
EYKLNDNNFPTIDPKDPYKLTDEESVLIDKLVYSFVNSDKLQKHVRFLFSKGNMYLKFNS
NLLFHGCIPLDDEGNLKSMCIQGEEYESKRLLEKFDSLSREGYFEKVGSEEKTYGMDIMW
YLWTGPVSPLFGKKQMATFERYFIDDEIAHIEQKTGYYKLRDREEMCDMILREFGLDPSE
SRIINGHVPVKKKNGESPIKANGKMIVIDGGFSKAYQKQTGIAGYTLIYNSYGLQLVSHE
HFSSTEESIMKEKDILSTTLVVEQKLKRKTVEDTDIGKDLQVQIKDLKELLLIYRKGIIK
EIR
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaaaatgaataagaatgagcaggaagatagtaaaaaactaaagtattttaga
ttgttagctaaacaatatcctaacattgctttagcatccacagaaattataaatttagaa
gcaattcttaatttacccaaaggtacagaacattttttaagtgacatacatggtgaatac
gagccttttgtacatgtattaagaaatggatctggagttgtaaaaagaaagatagaagat
cttttttgcaaatctttattagaaagtgatataaagagtttagcaactttaatatattat
ccagaacaaaaattggatatagttttaaaagaagaacgtaatatagatgattggtataaa
ataacgttaaatagacttatagaaatatgtagattttgttcatccaaatatacaagatct
aaagtaagaaaggctttaccagctgattttgcttatataatagaggaactattacatgaa
cagtttaatggaatagataaagaagagtattacgatagaataataactacaattatagat
ataggaagagcaaaagaatttataattgctttatcaaagcttattcaaaggatgattata
gatagacttcacataataggagatatatatgatagaggaccaaggccagatattataata
gacacccttatggaatatcattcggtagatattcaatgggggaatcatgatatgctttgg
atgggagcagctgcaggagtaagaacttgtgttgctaatgttttaagaatatctacaagg
tatgcaaatttagatttggttgaagaaatttacggaataaatcttttacctttagcaacc
tttgcattaaagtattatagagatgatccatgtgaatcatttattccaaaagtaaaggaa
gatgatcctgctgcaagtcaagaagtagatttagtatctaaaatgcataaagctataaca
atattacagtttaaactagaaaaagaaataatcgatagaaggccagaatttgaattagaa
ggaagactattattagataaaatagattatgaaaaagggactataatattaaatggaatt
gaatataaattaaatgataataattttccaacgatagatcctaaagatccatataaactt
acagatgaggaatcagtccttatagataaacttgtctattcttttgtaaatagtgataaa
ttacaaaagcatgttagatttttattttctaaaggaaatatgtatttaaagtttaattct
aatttattatttcacggatgtatacctttagatgatgaaggaaatttaaaaagtatgtgt
atacaaggcgaagaatatgaaagtaaaagattattagaaaaatttgattcgttatctaga
gaaggttactttgaaaaagttggcagtgaagaaaagacttatggaatggatataatgtgg
tatttatggacaggcccagtatcaccgttatttggtaaaaaacaaatggctacatttgaa
agatattttatagatgacgaaatagctcatatagaacagaagacaggatattataaatta
agagatcgagaagaaatgtgtgatatgattcttagagaatttggattagatccaagtgaa
tctagaattataaatggacatgtaccagtaaaaaagaaaaatggagaaagtccaataaag
gctaatggtaaaatgatagttattgatggtggtttttctaaggcatatcaaaaacaaact
ggcatagcaggatatacattgatatacaattcttatggattacaattagtttcccatgaa
cacttttcatctacagaagagtccataatgaaagaaaaagatattttatctacaactctt
gtagtggagcaaaaactcaaacgaaaaacagtagaagacacagatataggtaaagattta
caagttcaaattaaagatttaaaggaattattattaatatatagaaaaggaataataaaa
gaaataagataa

DBGET integrated database retrieval system