KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A2898Help
Entry
CLL_A2898         CDS       T00696                                 

Gene name
thrC
Definition
(GenBank) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLL_A2898 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLL_A2898 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLL_A2898 (thrC)
Enzymes [BR:cbk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLL_A2898 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2977054..2978517)
Genome map
AA seq 487 aa AA seqDB search
MKFRSTRGLEHGVASAIAIINGISKDGGLYVPESFPNMYSSLKSKMEFSYEELAFEIING
YFTDIDDEDLKEAINEAYNNRFEVKVHNNFLELYHGPTCAFKDAALLFLPQIMKRAKKIC
NKEEEIVILAATSGDTGKAALEGFKNIDGFKVVVYYPKKGVSAIQERQMITQQGNNVKVI
GINGNFDDAQRSVKEIFGDNDFKDNLLKKGVALSSANSINIGRLVPQIVYYFYGYFNLVK
KGAIKQGEKINVVVPTGNFGNILASYYAKQMGLPIDKFICASNENKVLTDFFKSGIYDKR
RELVLTESPSMDILVSSNLERLLFEASGRNPEVINNLMNSLNENGIYEINNDMKKFMKDF
YGEYATTEEVSDAIKEVYKKDSYLMDTHTAVGYVVKNKYQAETNDTKEVLIASTASPFKF
PRSICKALNISNDGIDDFEVLKKLSEITKNNIPESLANLSEYEIFHDEVWDKSEMKKALL
CYLGIEG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttagaagcactagggggctagaacatggagtggcttctgcaatagcaataata
aatggaatttctaaagatggaggactttatgtacctgaaagttttcctaatatgtattca
tcattaaagagtaaaatggaatttagttatgaagaattagcatttgaaattattaatgga
tattttactgatattgatgatgaggatttaaaggaagcaattaatgaagcatataataat
aggtttgaagttaaggtacataataactttttagaactatatcatggtccaacttgtgca
tttaaggatgcagcattgctatttctcccacagataatgaaaagagcaaaaaagatttgc
aacaaagaggaagaaatagtaatattagcagcgacatcaggagatacaggaaaagcagca
ttagagggattcaaaaatattgatggatttaaagtagttgtatactatcctaaaaaaggt
gtaagtgctatacaagaaagacaaatgataactcaacaaggcaataatgttaaagttatc
ggaataaacggcaattttgatgatgcacaaagatctgtgaaagaaatatttggagacaat
gattttaaagataacctattaaagaaaggtgttgctttatcatctgcaaattctataaat
ataggtaggttagttccacaaatagtatattacttttatgggtatttcaacttagtgaaa
aaaggggctataaaacaaggtgaaaaaattaatgtagtagttccaacaggaaactttgga
aatatattggcatcatactatgctaaacaaatgggacttcctatagataagtttatctgt
gcttcaaatgaaaataaagttttaacagatttctttaaaagtggcatttatgataagaga
cgtgaacttgtattaacagaatcaccatcaatggatatcttagtatcatctaatcttgag
agattgttatttgaggcaagtggacgaaatccagaagttataaataatcttatgaattca
ttgaatgaaaatggtatatatgaaataaataatgatatgaaaaaatttatgaaagatttt
tacggagaatatgctacaacagaagaggtatctgatgcaataaaagaagtttataaaaaa
gatagttacttgatggatactcatacagctgttggttatgttgttaaaaataaatatcaa
gcagagactaatgatactaaagaagtattaatagcttcaactgctagtccgttcaaattt
ccaagaagtatttgcaaggcattaaatatttcaaatgatggaattgatgattttgaggta
ttaaaaaagttatctgaaattacaaaaaacaatatacctgagagtttggctaatttatca
gaatatgaaatttttcatgatgaagtttgggataagtctgagatgaaaaaggcattactt
tgttatcttggaattgaagggtag

DBGET integrated database retrieval system