KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A3064Help
Entry
CLL_A3064         CDS       T00696                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00010  Glycolysis / Gluconeogenesis
cbk00051  Fructose and mannose metabolism
cbk00562  Inositol phosphate metabolism
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01120  Microbial metabolism in diverse environments
cbk01130  Biosynthesis of antibiotics
cbk01200  Carbon metabolism
cbk01230  Biosynthesis of amino acids
Module
cbk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A3064 (tpiA)
   00051 Fructose and mannose metabolism
    CLL_A3064 (tpiA)
   00562 Inositol phosphate metabolism
    CLL_A3064 (tpiA)
Enzymes [BR:cbk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLL_A3064 (tpiA)
Exosome [BR:cbk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLL_A3064 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLL_A3064 (tpiA)
  Exosomal proteins of melanoma cells
   CLL_A3064 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACD22909
UniProt: B2TPX3
Position
complement(3168241..3168987)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTVDEAVKVVEELKPLVKDATCDVVVCPTFVCLDAVKKATAGSNIKV
AAQNMHFEESGAFTGEVAPGMLEAMGIEYVVLGHSERREYFNETDEAINKKVKAAFAHNI
TPIVCCGETLEQRESGVTNNFIACQIKVDIAGLTKEQAEKVVIAYEPIWAIGTGKTATKE
QANETILAIRNVVVEMYGKEVADKVRIQYGGSVKPNTITEQMAMSDIDGALVGGASLKAE
DFSGIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattattgcgggaaactggaaaatgaataaaactgttgatgaagcagtt
aaagttgtagaagaattaaaaccattagttaaggatgctacttgtgatgtagttgtatgt
cctacatttgtatgtttagatgctgttaaaaaagcaacagctggatcaaatataaaagtt
gcagctcaaaatatgcactttgaagaaagtggcgcatttacaggagaagttgctccagga
atgttagaagctatgggaattgaatatgttgttttaggacacagtgaaagaagagaatac
ttcaatgaaactgatgaagcaataaacaaaaaggttaaagcagcatttgctcacaacatt
actccaatagtttgttgtggagaaactttagaacaaagagaaagcggagttactaataac
tttatcgcttgccaaattaaagttgatattgctggattaactaaagaacaagctgaaaaa
gttgttatagcttatgaaccaatctgggctattggaactggtaaaactgctactaaggaa
caagctaatgaaacaatattagcaatcagaaacgttgtagtagaaatgtacggtaaagaa
gttgctgataaagtaagaattcaatacggtggatcagttaaaccaaatacaatcactgaa
caaatggctatgtctgatatagatggagcattagttggtggagctagcttaaaagcagaa
gatttttctggaatagttaactactaa

DBGET integrated database retrieval system