KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A3172Help
Entry
CLL_A3172         CDS       T00696                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00040  Pentose and glucuronate interconversions
cbk00052  Galactose metabolism
cbk00500  Starch and sucrose metabolism
cbk00520  Amino sugar and nucleotide sugar metabolism
cbk01100  Metabolic pathways
cbk01130  Biosynthesis of antibiotics
Module
cbk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLL_A3172 (galU)
   00052 Galactose metabolism
    CLL_A3172 (galU)
   00500 Starch and sucrose metabolism
    CLL_A3172 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CLL_A3172 (galU)
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLL_A3172 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD DUF4806
Motif
Other DBs
NCBI-ProteinID: ACD25126
UniProt: B2TQA1
Position
complement(3291053..3291925)
Genome map
AA seq 290 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNK
KCIEDHFDKSIELEFELEKSGKEELLELVRNISDMVDIHYIRQKEPKGLGHAIHCAKTFV
GNEPFAVLLGDDVVDSEKPCLKQLIDCFSEYNTTILGVQTVAQENVSKYGIVDGLHIEDR
VYKVKDLVEKPSVEEAPSNVAILGRYIITPEIFNILENTKPGKGGEIQLTDALKTLISKE
AMYAYNFEGRRYDVGDKLGFLQATVEFALKREELREPFIEYLKGNPWDEK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaagccattattccagcagctggactaggaacaagatttttaccagca
actaaagcgcaaccaaaggaaatgcttcctatagttgacaaaccaacaattcaatacata
attgaagaggcagttgcatcgggaatagaagaaatacttattataacaggaagaaataaa
aagtgtatagaagatcattttgataaatctatagaattagaatttgaattagaaaagtca
ggaaaagaagaacttttagaattagtaagaaatatttctgatatggttgatatacattat
attagacaaaaagaacctaaaggattaggtcatgcaattcattgtgcaaaaacatttgtg
ggtaatgaaccttttgcagttttattaggtgatgatgttgttgacagtgaaaaaccatgt
ttaaaacaattaatagattgttttagtgagtataatactactattttaggtgttcaaact
gtagcacaagaaaacgtatcaaaatacggaatagttgatggacttcatatagaagataga
gtctataaagtaaaggatttagttgagaagccatcagtagaagaagcacctagtaatgta
gctattttagggagatatattataacacctgaaatatttaatatattagaaaacacaaag
ccaggaaaaggcggagaaattcaactaactgacgcattaaaaactttaattagtaaagaa
gcaatgtatgcttataattttgaaggcagaagatatgatgtaggagataaacttgggttt
ctacaagcaacagtagaatttgcattaaaaagagaagaattaagagagccttttatagaa
tatctaaaaggcaatccatgggatgaaaaataa

DBGET integrated database retrieval system