KEGG   Clostridium botulinum B Eklund 17B: CLL_A3337Help
Entry
CLL_A3337         CDS       T00696                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLL_A3337 (pfkA)
   01230 Biosynthesis of amino acids
    CLL_A3337 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A3337 (pfkA)
   00030 Pentose phosphate pathway
    CLL_A3337 (pfkA)
   00051 Fructose and mannose metabolism
    CLL_A3337 (pfkA)
   00052 Galactose metabolism
    CLL_A3337 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLL_A3337 (pfkA)
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLL_A3337 (pfkA)
Protein phosphatases and associated proteins [BR:cbk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLL_A3337 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3511339..3512301)
Genome map
AA seq 320 aa AA seqDB search
MKKIAILTSGGDAPGMNAAIRAVVRTAIDKGLEVMGVQRGYSGLLNGELFAMNRTSVSDI
IQRGGTILRTARCPEFKDEEVRKRAVKILNAYGVDALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTIGFDTALNTIVDAINKIRDTSTSHERVSIIEVMGRDCGDLALHA
GISSGAEAIIVPEMGEFDRDALCRTILDGKNHGKTHSIVILAEGIGGAEELSKYVQELTG
IEARATILGHIQRGGAPSASDRVLASRLGARAVEVLLQGETSRVIGIRDNQIVDQDIDEA
LAIESKFDLDLYNVAEVLSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctattttaacaagtggtggagatgccccaggaatgaacgcagctata
agagcagtagtaagaacagccattgacaaaggacttgaagttatgggagttcaaagaggc
tacagtggattacttaatggtgaactatttgcaatgaatagaacatcagtatctgatatt
attcaaagaggtggaacaatcctaagaactgctagatgcccagagttcaaagacgaagag
gtaagaaaaagagcagttaagatattaaatgcttatggtgtagatgctttagttgttatt
ggtggagatggatcttttatgggagccaaactactatcaaaactaggaatcaaaactata
ggattaccaggaacaatagataatgatttagcttatactgatttcacaataggatttgat
acagcattaaatactattgttgatgcaataaataaaataagagatacatcaacttctcat
gaaagagtttcaataattgaagttatgggaagagattgtggagacttagctcttcatgct
ggtatatcaagtggagcagaagctataatagttccagaaatgggtgaattcgatagagat
gcactttgcagaactatattagatggtaaaaaccatggaaaaactcatagcatagttatt
cttgcagaaggaattggtggagcagaagaactatcaaaatatgttcaagaattaacagga
atagaagcaagagctacaatattaggtcatatccaaagaggtggagcaccatctgcatca
gatagagttttagcttcaagattgggagctagagcagtagaagttcttttacaaggagaa
acttcaagagtaataggaattagagacaatcaaattgtagaccaagatatagatgaagca
ttagctatagaaagtaagtttgacttagatctatataatgtagcagaagtattatcacgc
taa

DBGET integrated database retrieval system