KEGG   Clostridium botulinum B Eklund 17B (NRP): CLL_A3337Help
Entry
CLL_A3337         CDS       T00696                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbk  Clostridium botulinum B Eklund 17B (NRP)
Pathway
cbk00010  Glycolysis / Gluconeogenesis
cbk00030  Pentose phosphate pathway
cbk00051  Fructose and mannose metabolism
cbk00052  Galactose metabolism
cbk00680  Methane metabolism
cbk01100  Metabolic pathways
cbk01110  Biosynthesis of secondary metabolites
cbk01120  Microbial metabolism in diverse environments
cbk01130  Biosynthesis of antibiotics
cbk01200  Carbon metabolism
cbk01230  Biosynthesis of amino acids
cbk03018  RNA degradation
Module
cbk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A3337 (pfkA)
   00030 Pentose phosphate pathway
    CLL_A3337 (pfkA)
   00051 Fructose and mannose metabolism
    CLL_A3337 (pfkA)
   00052 Galactose metabolism
    CLL_A3337 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLL_A3337 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLL_A3337 (pfkA)
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLL_A3337 (pfkA)
Protein phosphatases and associated proteins [BR:cbk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLL_A3337 (pfkA)
Messenger RNA biogenesis [BR:cbk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLL_A3337 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACD24269
UniProt: B2TQR6
Position
complement(3511339..3512301)
Genome map
AA seq 320 aa AA seqDB search
MKKIAILTSGGDAPGMNAAIRAVVRTAIDKGLEVMGVQRGYSGLLNGELFAMNRTSVSDI
IQRGGTILRTARCPEFKDEEVRKRAVKILNAYGVDALVVIGGDGSFMGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTIGFDTALNTIVDAINKIRDTSTSHERVSIIEVMGRDCGDLALHA
GISSGAEAIIVPEMGEFDRDALCRTILDGKNHGKTHSIVILAEGIGGAEELSKYVQELTG
IEARATILGHIQRGGAPSASDRVLASRLGARAVEVLLQGETSRVIGIRDNQIVDQDIDEA
LAIESKFDLDLYNVAEVLSR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatagctattttaacaagtggtggagatgccccaggaatgaacgcagctata
agagcagtagtaagaacagccattgacaaaggacttgaagttatgggagttcaaagaggc
tacagtggattacttaatggtgaactatttgcaatgaatagaacatcagtatctgatatt
attcaaagaggtggaacaatcctaagaactgctagatgcccagagttcaaagacgaagag
gtaagaaaaagagcagttaagatattaaatgcttatggtgtagatgctttagttgttatt
ggtggagatggatcttttatgggagccaaactactatcaaaactaggaatcaaaactata
ggattaccaggaacaatagataatgatttagcttatactgatttcacaataggatttgat
acagcattaaatactattgttgatgcaataaataaaataagagatacatcaacttctcat
gaaagagtttcaataattgaagttatgggaagagattgtggagacttagctcttcatgct
ggtatatcaagtggagcagaagctataatagttccagaaatgggtgaattcgatagagat
gcactttgcagaactatattagatggtaaaaaccatggaaaaactcatagcatagttatt
cttgcagaaggaattggtggagcagaagaactatcaaaatatgttcaagaattaacagga
atagaagcaagagctacaatattaggtcatatccaaagaggtggagcaccatctgcatca
gatagagttttagcttcaagattgggagctagagcagtagaagttcttttacaaggagaa
acttcaagagtaataggaattagagacaatcaaattgtagaccaagatatagatgaagca
ttagctatagaaagtaagtttgacttagatctatataatgtagcagaagtattatcacgc
taa

DBGET integrated database retrieval system