KEGG   Clostridium botulinum B Eklund 17B: CLL_A3397Help
Entry
CLL_A3397         CDS       T00696                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLL_A3397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLL_A3397
   00052 Galactose metabolism
    CLL_A3397
   00500 Starch and sucrose metabolism
    CLL_A3397
   00520 Amino sugar and nucleotide sugar metabolism
    CLL_A3397
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLL_A3397
   00524 Butirosin and neomycin biosynthesis
    CLL_A3397
Enzymes [BR:cbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLL_A3397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3577173..3578126)
Genome map
AA seq 317 aa AA seqDB search
MQKFVVGVDLGGTKISTALSNLNGEVISQTTVPTNAHEGEIPVLNRIIDSVDKVIKDGGV
TYKDIKAIGIGSPGPLDAEKGVIIYTPNLPFKNFNLVDPLNKKFEVPVFLDNDANVATIG
EFMFGAGRGAKNVLFFTVSTGVGGGAILDGKIYRGHTSNALEIGHMTVAPDGPRCNCGNI
GCVEATSSGTAIGKRGKEAIGSKVETSLRKYDDITSYEVFVEAAAGDPVCKDIIDNALNY
LGIAVANAVSIFDPEVIIIGGGVSKAGNIVFDTVRKVVDKRCFKSMAESVKIVPAGLGTD
AGVVGAVALALLETSEK
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttgtagtaggggttgacttaggaggaactaagataagtacagctttatca
aatttaaatggtgaagttattagccaaacaacagttccgactaatgcacatgagggagaa
attccagtattaaatagaataatagactcggtagataaggtaataaaagatggtggagtt
acttataaagatataaaagcaataggtattggttctccaggaccacttgatgcagaaaag
ggagtaataatatacacacctaatcttccatttaaaaactttaatttagtggatccacta
aataagaagtttgaagtacctgttttcttagataatgatgcaaacgttgcgactattggt
gagtttatgtttggagcaggaagaggtgctaaaaacgtattattctttacagtaagtaca
ggcgtaggcggtggagctatattagatggaaaaatatatagaggtcatacatcaaatgca
ttagaaataggtcatatgactgtagcacctgatggtccaagatgtaattgtggaaatatt
ggttgtgtagaagcaacttcatcaggaacagctataggtaaaagaggtaaagaagctata
ggaagtaaagttgaaacatcattaagaaaatatgatgatataacttcatatgaagtattt
gtagaagcagcagctggagatccagtatgtaaagatataatagataatgcattaaattat
ttaggaatagctgttgcaaatgcagtatcaatttttgatccagaagtaataataattggt
ggaggcgtttcaaaagctggaaatattgtatttgatacagtaagaaaagttgtagataag
agatgttttaaatcaatggctgaatcagttaaaattgtaccagcaggacttggaacagat
gcaggtgttgtaggagcagtagctttagcattacttgaaacttcagaaaaataa

DBGET integrated database retrieval system