KEGG   Clostridium botulinum B Eklund 17B: CLL_A3417Help
Entry
CLL_A3417         CDS       T00696                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cbk  Clostridium botulinum B Eklund 17B
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLL_A3417 (glgB)
Enzymes [BR:cbk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CLL_A3417 (glgB)
Exosome [BR:cbk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLL_A3417 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3602858..3605095)
Genome map
AA seq 745 aa AA seqDB search
MSNAYTKKIDPELDIESKEIISEEILKDTAKDTSKAAKKISSSKKSNRTTKKKASSVKTK
ANSSNSNSENKEVKSNTKKSNSHELNKENIKKFHEGTNYEAYKILGSHIKTEKRKKGVRF
TTWAPNAKDAYLVGDFNDFKIDENYKLEKLDENGLWSVFLPHINDGSKYKYCFIDELGNQ
SDFKSDPYAIQSELRPKTASIVFELDKFKWNDKKWMSKRNKLNIYEMPMNIYEMHLGSWK
RNEEGEFLTYAQLSEILPKYLKDMGYTYVELMPLGEHPLDASWGYQGTGYYSPTSRYGDL
NGLKMLIEKLHDEEIGVIIDWVPGHFCKDSHGLYKFDGTTTYEYSEEWRSENCGWGTCNF
DLGKPEVRSYLISNALYWIREFHIDGIRVDAVSSILYLDYGKEEGEWEPNQFGGNANLEG
IEFLKQLNKAVKAEDSNILMIAEESTSWPNVSKSNNGESLGFNFKWNMGWMNDTLEYIKV
DPIYRKFNHDKVTFSMMYNYSENFILPISHDEVVHGKKSLVDKMWGDYWNKFSGLRLFAS
YMMGHPGKKLLFMGCEFGQFIEWREYEELEWFLIDKYDMHRQTQVFFKDLNHFYIDNKAL
WELDHDEKGFTWIDADNNSQSILEFIRRSKDDNDTLIFISNFTPIVYYDYKIGVPFLGEY
EEVFNTDDSKYGGSGQVMGETLISEKLEYHNQPYSLQIKVPPMATLVLKIKSIYKDVEEK
TFMKKVTEIAEIDRDELLDKIEDIK
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaatgcttataccaagaagatagatcctgaattggatattgaatcaaaagaaatt
atatcagaagaaatactaaaagacacagcaaaagatacaagtaaagctgctaaaaaaata
agttcgtctaaaaaatcaaatcgaactactaagaaaaaagcctcaagtgtaaaaacaaaa
gcaaattcaagcaatagtaacagtgaaaataaagaagtaaaaagcaatactaaaaaatca
aattctcatgaattaaataaagaaaacattaaaaagtttcatgaaggaactaactatgaa
gcttataagattttaggatctcatataaaaacagaaaaaagaaaaaaaggagtaaggttt
acaacctgggcgcctaatgcaaaagatgcttatttagttggagattttaatgattttaaa
atagatgaaaattataaacttgaaaagttagatgaaaatggattgtggagtgtattttta
ccacatataaatgatggtagtaaatataaatactgctttatagatgaattaggaaatcaa
tcagattttaaatcagatccttatgcaatacaaagtgaacttagacctaagactgcatca
atagtgtttgaattagataagtttaaatggaatgataaaaaatggatgagtaaaagaaat
aaattaaatatatatgaaatgccaatgaatatatatgaaatgcatttaggttcatggaaa
cgaaacgaagagggagaatttttaacatatgcgcagttgagtgaaattttaccaaaatat
cttaaagatatgggttatacttacgttgaattgatgccacttggtgaacatccattagat
gcatcttggggatatcaaggaactggatattattctccaacaagtagatatggagattta
aatggtttaaaaatgcttatagaaaagttacatgatgaagaaattggtgtaataattgac
tgggttccaggacatttttgtaaagattctcatgggctatataaatttgatggaactaca
acatatgagtatagcgaagaatggagatcggaaaattgtggttggggaacttgtaatttt
gatttaggaaaaccagaagttcgtagttacttaatatcaaatgctctgtattggataaga
gaatttcatatagatggaattagagttgatgctgtatcaagtattctttacttagattat
ggtaaagaagaaggtgaatgggagcctaatcaatttggaggaaatgcaaatttagaaggt
atagagtttttaaaacaattaaacaaggctgttaaagcggaagattctaatatattaatg
attgcagaagaatcaacatcatggcctaatgttagtaaatctaataatggagaatcatta
ggatttaattttaaatggaatatgggatggatgaacgatactttagaatatataaaagta
gatcctatatatagaaaattcaaccatgataaagtaactttttcaatgatgtacaattat
tcagaaaattttatattaccaatatcacatgatgaagtagtacatggtaaaaaatcattg
gttgataaaatgtggggagattattggaataagttttctggcttaagattgtttgcatct
tatatgatgggacacccaggtaaaaagttattatttatgggatgtgaatttggacaattt
atagagtggagagaatatgaagaattagagtggtttttaatagataaatatgatatgcat
agacagacacaagttttctttaaagatttaaatcatttttatatagataataaagcactt
tgggaattagatcatgatgaaaaaggttttacctggattgatgcagataacaattctcaa
agtatacttgagtttataagaagaagtaaagatgacaatgatactttaatttttattagt
aattttactccaattgtatattatgactataaaattggtgttccatttttaggtgaatat
gaagaagtatttaatacagatgatagtaagtatggtggttcaggacaagttatgggtgaa
acattaatatcagaaaaattggaatatcacaatcaaccatattcattacaaattaaagta
cctcctatggcaacattagtgctaaaaataaaatctatatataaagatgttgaagaaaaa
acttttatgaagaaagtgactgaaatagcagagatagatagagatgagttattagataaa
attgaggatataaaataa

DBGET integrated database retrieval system