KEGG   Clostridium botulinum A3 Loch Maree: CLK_0359Help
Entry
CLK_0359          CDS       T00670                                 

Gene name
cobA_hemD
Definition
(GenBank) uroporphyrinogen III synthase/methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00860  Porphyrin and chlorophyll metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLK_0359 (cobA_hemD)
Enzymes [BR:cbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLK_0359 (cobA_hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLK_0359 (cobA_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: ACA54119
UniProt: B1KY16
Position
1076813..1078273
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIRALKKCTAVMYDRLANGELLKYLAPSCEIYYCGKEPGC
HYKSQDEINKMLVKLAKEGHIVGRIKGGDPYVFGRGGEEALDLLEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKESKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDELN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNAEENLKPYLNRLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIKVRGIMPSIKSKHFVAE
SLFEEMKKHVQSGDKVLVPRSKDARPFLVDALKKEGCIVDEVHIYETLCGQSSHAERFED
VDTVLFTSPSTVKNMISMVGIDSIKEKNIIAIGPITAAELDKNNIKCSICDEYSINGIID
KLLDLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggtatatttaattggtgcagggccgggtgatgaagaactaataactctaaaa
gctataagagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaagttgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaagaaggccat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttagatcttttagaagaaaatatagaatttgaagttatacctggagtgacttctccagta
tctgtactaaattatgcaggaattcctataacccataggggaatatcaagaggatttcat
atttttacagcaatgactaaggataaattagatatagattggaaatctgtagttaatata
ggaggaaccttagtatttttaatgggtcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaagtaaagtagcagtggttatgaaaggaactacctca
aagcaaaaaaaggttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagaatctccagtaataatagtagtaggagaagtagttagtttttcagatgaattaaat
tggtatgaaaaaaagcctttgttcggaagaaatatatgtataacccgtacaaaagagcag
gctaaggagttaaaagttcaacttttagatttaggggctgaagtcacagaaataaattct
atagaaataaaaaatgcagaggagaacttaaagccttatttaaatagattaaaagaatat
gattatatagcattaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaatgctaaatttgcagctataggaccagctactagt
gaagcaataaaagtgcgaggaataatgccaagtataaaatcaaagcattttgtagctgaa
agtctttttgaagaaatgaaaaagcatgttcaaagtggggataaggtacttgtacctcgc
tcaaaagatgcaaggccctttcttgtagatgcattaaaaaaagaaggttgcattgtagat
gaagtacatatatatgaaactttatgtggacaatcttctcatgctgaaagatttgaagat
gtagatacagtattatttacaagtccatcaactgttaaaaatatgatttctatggtgggg
atagatagtataaaagaaaaaaatattatagcaataggtcctattacagcagcagaatta
gataaaaataatataaaatgcagtatttgtgatgaatattctataaatggcataatagat
aaacttttagaccttaactag

DBGET integrated database retrieval system