KEGG   Clostridium botulinum A3 Loch Maree: CLK_0360Help
Entry
CLK_0360          CDS       T00670                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00860  Porphyrin and chlorophyll metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLK_0360 (hemB)
Enzymes [BR:cbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CLK_0360 (hemB)
Exosome [BR:cbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLK_0360 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD DNA_photolyase DUF1462 NTase_sub_bind
Motif
Other DBs
NCBI-ProteinID: ACA57204
UniProt: B1KY17
Position
1078403..1079377
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENVKEEISSLPGNYHYSIDRLEE
LVEEVRKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLKELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
LKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatgtt
aaagaagaaatatcttcactaccagggaattatcattattctatagatagattagaagaa
ttagtagaggaagtaagaaaatcaggcataaaaggtataatgatatttggagtaccagat
cataaagatgaatgtggttctgcagcctttgatgataatggaatagttcaaaaaggtata
agaagattaaaagaattaatgccagaattatatatagttgcagatgtatgcatgtgccaa
tatacaagtcatggacattgtggaataatccatggtcataatgtggacaatgatgaatca
ttaaaatatttagcaaaaatatctttatcttatgcaaaagccggtgcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgagaataat
cttaaacatgtaggcataatggcatatagtgcaaaatattgttcagctttctatggtcct
ttcagagaagcagctaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaaaccagctttaccatacttagatgttataagaatggcaaaggataga
tttgaattcccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagcg
gctaagcaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggttaaaa
gaagacagaaaatag

DBGET integrated database retrieval system