KEGG   Clostridium botulinum A3 Loch Maree: CLK_0360Help
Entry
CLK_0360          CDS       T00670                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1078403..1079377
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENVKEEISSLPGNYHYSIDRLEE
LVEEVRKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLKELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
LKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatgtt
aaagaagaaatatcttcactaccagggaattatcattattctatagatagattagaagaa
ttagtagaggaagtaagaaaatcaggcataaaaggtataatgatatttggagtaccagat
cataaagatgaatgtggttctgcagcctttgatgataatggaatagttcaaaaaggtata
agaagattaaaagaattaatgccagaattatatatagttgcagatgtatgcatgtgccaa
tatacaagtcatggacattgtggaataatccatggtcataatgtggacaatgatgaatca
ttaaaatatttagcaaaaatatctttatcttatgcaaaagccggtgcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgagaataat
cttaaacatgtaggcataatggcatatagtgcaaaatattgttcagctttctatggtcct
ttcagagaagcagctaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaaaccagctttaccatacttagatgttataagaatggcaaaggataga
tttgaattcccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagcg
gctaagcaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggttaaaa
gaagacagaaaatag

DBGET integrated database retrieval system