KEGG   Clostridium botulinum A3 Loch Maree: CLK_0421Help
Entry
CLK_0421          CDS       T00670                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLK_0421
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLK_0421
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLK_0421
Enzymes [BR:cbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLK_0421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1130589..1131707
Genome map
AA seq 372 aa AA seqDB search
MIERNKSIKNLYCIRCNKKYGISDYFRGCEKCLNDGLPASVTFHYGVGESVNNINEMFPY
SMQSMLGEGNTPIISHKKISDIYGIESFYLKNEFQNPTGSHKDRMSPYIVARAIEMKRKG
VVVASSGNAGISIASYASYKGVKSIVVTTKGINPVYERAIEATGAQIIITETSDERWNIV
KKLVDIEGWYPATNYINPPVGSNPFGVQGYKKIAFEIYEFFNEKLPTHILIPVSRGDLLW
GVYEGFKNLLQLGYIIEIPKLIAVEPIPRIESVLKGKSYIKKFKGDYSKTPSIGGDTVTY
QSIKAIKETNGCAITVNAEKIPSALKLIGSSGVYLETSSALAIQGLCILREKEIINENSR
VLMIATSHGYKN
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgagagaaataaatccataaaaaatttgtattgtattaggtgcaataaaaagtat
ggaatatcagattattttagggggtgtgaaaaatgtttaaatgatggactaccagcaagt
gtaacatttcattatggagtaggggaaagtgttaataatataaatgagatgtttccctat
tcaatgcaatcaatgttaggtgaaggtaatactccaataattagtcataaaaagatcagt
gatatatatggaattgaaagtttttatttgaaaaacgaatttcaaaatccaacaggatca
cataaggatagaatgagtccttatattgttgctagggcaatagagatgaaaagaaaaggg
gtggtagtagcctcaagtggaaatgcaggtatttctatagcatcttatgctagttataag
ggggtgaaatctatagtagttactactaagggaataaacccagtttatgagagagccatt
gaagctactggtgcacaaattataattaccgaaacatcagatgaaagatggaacatagtt
aagaaattagtagatatagaaggttggtacccagcgacaaactatataaatccacctgtt
ggcagcaatccatttggagtacaaggctacaaaaaaatagcctttgagatatatgaattt
tttaatgaaaaactacccactcatatattaattccggtttcaagaggagacttactatgg
ggagtatatgaaggcttcaaaaacttacttcaactaggttatattatcgaaataccaaaa
ttaattgcagttgaacctataccaagaattgaatctgttctaaaaggtaaaagttatatc
aaaaaatttaaaggagattactcaaaaactccttccataggaggcgatactgttacatat
caatcaataaaggcgataaaagaaacgaatggatgtgcaataactgtaaatgcagagaaa
ataccttccgcattaaaattaattggaagtagtggtgtatacttagaaacatcttcagca
ctagctattcagggactttgtattcttagggaaaaggaaattattaatgagaatagtcgt
gtacttatgattgccacttcacatggatataaaaactaa

DBGET integrated database retrieval system