KEGG   Clostridium botulinum A3 Loch Maree: CLK_0574Help
Entry
CLK_0574          CDS       T00670                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLK_0574
Enzymes [BR:cbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLK_0574
    3.5.1.-  
     CLK_0574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1309304..1309864
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFKIN
GGIWPVHCVANRFGAKLEESFYKELQHKNHSPNNKKILFLKGKNDYIEEYSAYEGENILG
NKINEILDKDVIVCGIASEFCVKETVEDLIRNGFNVELYIDGVAYVNKKEHEKTLNNLRE
QGIKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaatcaatacttataatagactgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaacattataaatttattaaatataaataaagat
ttaaaagtattttactctttagattggcatagtgaaaataataaatcttttaaaataaat
ggtggtatatggccagtacattgtgtagccaatagatttggtgctaaattagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttta
aaaggaaaaaatgattatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaaatattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtggaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
caggggattaagtttatttaa

DBGET integrated database retrieval system