KEGG   Clostridium botulinum A3 Loch Maree: CLK_0713Help
Entry
CLK_0713          CDS       T00670                                 

Gene name
araD
Definition
(GenBank) L-ribulose-5-phosphate 4-epimerase (EC:5.1.3.4)
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLK_0713 (araD)
Enzymes [BR:cbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CLK_0713 (araD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1452912..1453559
Genome map
AA seq 215 aa AA seqDB search
MNNETYLRLQIVEAGKRLQQRFFIASNDGNISAKLDDNTILITPTGVNKGEVTPDQIIKV
DREGNVIEGHMKVTSEIKMHLAVYNMRVDVKAIVHAHPPASTAFSVSKEKLDDPVILPEA
VFSLGKIGYCEYGTPSTDEVPKAVEKEIPYSDVLLLSNHGALTVGTDVMQAYYRMENLEM
VSKVTIYSKIIGNIKTLNELQVEKLNKVKEEKGWG
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
ttgaataatgaaacgtatttaagactacaaattgtagaggcaggaaaaagactccaacaa
agattttttatagcttcaaatgatggaaatataagtgctaaacttgatgataatactata
ttgattacgcctacaggagttaacaaaggagaagtaactccagatcaaataataaaagta
gatagagaaggaaatgttatagaaggtcatatgaaggttacatctgaaataaaaatgcac
ttagctgtttataatatgagagtagatgtaaaagctatagttcatgcccatccaccagca
tctacagctttttcagtatcaaaagaaaaactagatgatcctgttattcttccagaagca
gttttttcattagggaaaataggatattgtgaatatggaactccttctactgatgaggtt
ccaaaagctgtagaaaaagaaattccatatagtgatgtacttttattatctaaccatgga
gcccttacagtaggtacagatgtaatgcaggcttattacagaatggaaaatttagaaatg
gtttcaaaggtaactatttattcaaaaataataggaaatataaaaactttaaatgaacta
caagttgagaaattaaataaagtaaaagaagaaaaaggttgggggtaa

DBGET integrated database retrieval system