KEGG   Clostridium botulinum A3 Loch Maree: CLK_0938Help
Entry
CLK_0938          CDS       T00670                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CLK_0938 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLK_0938 (murE)
Enzymes [BR:cbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CLK_0938 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1697148..1698599
Genome map
AA seq 483 aa AA seqDB search
MNLNLILKSLGYSFIKEDKKEIEKIEYDSRKVKEGDLFICIEGYATDGHKYAKKAYDNGA
KVIVCEKDLEELSYYKDCTIIKVPDSRKALAIMASNYYGNPSKHIKIIGITGTNGKTTST
FMMKAILEKAGYKVGLLGTIANYIGNKKIESHRTTPESLELQKLFKDMVDEKVDYCVMEV
SSHSLYLDRVYGVEFKEAIFTNLTQDHLDFHKTFENYFNSKLILFKNAQNSVINIDDSYG
EKVLKKALGNKITYGVEKNCDLKAENLHMHSRGVEFDTIFKNEKETIALNIPGKYNIYNA
LGSIGACLLEGIPLKTIKEALADMPSVPGRCEIVTKNYNLGYDVIVDYAHTPDGLENILN
TAREFTKGRLISVYGCGGDRDRTKRPIMGKVGSNLSDIAIITSDNPRTEDPTLIIKDVLE
GIEKDNYIVVEGRRDAIRKAMEIAKENDVIVVAGKGHEDYQILKDKTIHFDEREVIEELI
KEV
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaatttaatactaaagtcattaggatattcttttataaaagaagataaaaag
gaaatagaaaagatagaatatgattcaagaaaagttaaagagggagatttatttatttgt
atagagggatatgcaacagatgggcataaatatgcaaaaaaagcttatgacaatggagct
aaagtaattgtttgtgagaaggatttagaagaattatcctattataaagattgtactata
ataaaggttccagatagtagaaaagccttagctataatggcatctaattattatggtaac
ccatctaaacatattaaaataataggtattacaggaacaaatggtaaaaccacatctact
tttatgatgaaagctatactagaaaaagcaggctataaagttgggcttttgggaactata
gcaaattatataggaaataaaaaaatagaatctcatagaactaccccagaatctctagaa
ctacaaaaattatttaaagatatggtggatgaaaaagtagattattgtgtaatggaagta
tcttctcattctttatatttagatagagtttatggagtagaatttaaagaggctatattt
acaaatttaacacaggatcatttggactttcataaaacctttgaaaattattttaattcc
aaactaattttatttaaaaatgctcaaaattcagtgataaatatagatgatagttatgga
gaaaaagtattaaagaaagctttaggaaataaaataacctatggtgtagagaaaaattgt
gatttaaaagcggaaaacttacatatgcattctagaggagtagaatttgatactatattt
aaaaatgaaaaagaaactatagctttaaatataccaggtaaatataatatatataatgct
ttaggaagtattggggcttgtcttttggagggtatccctttaaaaactataaaagaagca
ttagcagatatgccatctgtgccaggaagatgtgaaattgtaactaaaaattataattta
ggttatgatgttatagtagattatgcccatactccagatggattagaaaatatattaaat
actgctcgagaatttacaaagggaagattaataagtgtatacggatgcggtggagataga
gatagaactaaaagaccaattatgggaaaagtgggatcaaatttaagtgatatagctata
ataacctcagataatccaagaacagaggatccaacacttataataaaagatgtattagaa
ggtatagaaaaagataactatatagtagttgaaggaagacgagatgccataagaaaagct
atggaaatagcaaaagaaaatgatgttatagtagtagcaggaaaaggccatgaagattat
caaatattaaaggataaaactattcactttgatgaaagagaagtaatagaagagctaata
aaagaagtataa

DBGET integrated database retrieval system