KEGG   Clostridium botulinum A3 Loch Maree: CLK_1035Help
Entry
CLK_1035          CDS       T00670                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1799543..1800133
Genome map
AA seq 196 aa AA seqDB search
MAIDVKAIEEHIRGILIALGDNPEREGLKDTPKRVAKMYEEVFKGMCYSNDEIAEMFNIT
FEDDLCINDNENDMVFMKEIEIFSHCEHHLALMYNMKVAIAYIPKGKIIGLSKMARIADM
VGRRLQLQERIGSDIAEILQKITGSEDVAVIIEGEHGCMTTRGIKKSGTKTITTTLRGKF
NTDPIISNKLMMLYTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgttaaagcaattgaagaacacataaggggaattttgatagccttagga
gataatccagaaagggaaggcttgaaagatacgccaaagcgtgtagctaaaatgtatgaa
gaagtattcaaaggtatgtgttatagcaacgatgaaattgcagaaatgtttaatataacc
tttgaagatgatctatgtataaatgataatgaaaatgacatggtttttatgaaagaaata
gaaatatttagtcattgtgaacatcatttagcacttatgtacaatatgaaagtagccata
gcatatatacctaagggaaaaattattggtttaagtaaaatggcaagaatagcagatatg
gtaggacgtagactacagcttcaagagaggattggaagtgatatagcagaaatactgcag
aagataactggctcagaagatgtagctgttattatagaaggagaacatggctgtatgacc
actagagggataaaaaagtcaggtactaaaactataacaactacattaaggggaaagttt
aacactgatcctattataagcaataaattaatgatgctttatacgaaataa

DBGET integrated database retrieval system