KEGG   Clostridium botulinum A3 Loch Maree: CLK_1040Help
Entry
CLK_1040          CDS       T00670                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLK_1040 (rbsK)
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLK_1040 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1804259..1805161
Genome map
AA seq 300 aa AA seqDB search
MDIAVIGSNMVDLISYINRMPKEGETLEAPDFKMGCGGKGANQAVAAARLRSDVMMVSKV
GDDLFGQNTIKNFKNNGVNTGFVTVQKNQASGVAPIFVDRESRNSILIIKGANKNLSPTD
IDDASEELKKCSLIILQLEIELETVYYAIDFANKNNIPVLLNPAPAIKELDFNYVYKCDF
FVPNETELEILTNKPVNTIEGIRKAAHLIGDKGVKNVIVTMGSKGLLWINKDEEHFIKAR
KVDAVDTTGAGDGFIGCFAHYYVATKNILLALEKATAYAALSVTRYGTQTSYPTKEEFLK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggatattgcagttattggttcaaatatggtagatttgataagttatattaatagaatg
cctaaagaaggtgaaactctagaagcaccagattttaaaatgggatgtgggggtaagggg
gcaaaccaagccgttgcagctgcaagattaagatcagatgttatgatggtaagtaaggtt
ggagatgatttatttggacaaaacactattaaaaattttaaaaacaatggtgtaaataca
ggttttgtaactgttcaaaaaaatcaagctagtggagttgcacccatttttgttgatagg
gaatctagaaatagtattttaattattaaaggggccaataaaaatttatctcctacagat
atagatgatgcaagtgaagaattgaaaaagtgttctttaattattttacaattggaaatt
gaattagaaactgtttattacgctatagattttgctaataaaaataatatccctgtattg
ctaaatcctgcgcctgctataaaagaacttgatttcaattatgtttataaatgcgatttt
tttgttccaaatgaaacagaattagagattttaacaaataagcctgtaaatacaatagag
ggcataagaaaagctgctcatttaattggggataaaggtgttaaaaatgtaattgttaca
atgggtagtaaagggttgctgtggattaataaagatgaagaacattttataaaagcacgt
aaagttgatgctgtagacaccactggtgctggtgatggatttattggatgttttgcacat
tattatgtagctacaaaaaacatattattagctcttgaaaaagcaacagcttatgcagca
cttagtgttacaagatatggtactcaaacttcttatcctacaaaggaagaatttttaaaa
taa

DBGET integrated database retrieval system