KEGG   Clostridium botulinum A3 Loch Maree: CLK_1066Help
Entry
CLK_1066          CDS       T00670                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLK_1066
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLK_1066
   00052 Galactose metabolism
    CLK_1066
   00500 Starch and sucrose metabolism
    CLK_1066
   00520 Amino sugar and nucleotide sugar metabolism
    CLK_1066
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLK_1066
   00524 Butirosin and neomycin biosynthesis
    CLK_1066
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLK_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1835479..1836426
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGSPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGEGKGTKNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKEDKASKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVFDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaggga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggggtaaac
ttagaggaaataaaggctataggaataggttcaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactctagctgaa
tttatgtttggtgaaggaaaaggtaccaagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggccatacaactgttatgaaagatggaccgaactgtggttgtggtaataagggt
tgtgcagaaagtttaggctctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacgtctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaagaagataaggcttcaaaggaagttttagaattttgcttatcctattta
ggtataactgtagccaatataataaatacctttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttttgatataataaatagggaagtgaaaaataga
tgctggaaagctattagggataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system