KEGG   Clostridium botulinum A3 Loch Maree: CLK_1102Help
Entry
CLK_1102          CDS       T00670                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbl01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cbl00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cbl00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
1880092..1881573
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKTVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELKNMDYKELAFYIMKK
YFDDFNEEELKECIDKAYDSKFQDPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPYL
LKVSAKKMNITKDIVILTATSGDTGKAALEGFDSVDGTKIVVFYPKDGVSEIQKMQMVTQ
EGKNTFVVGIEGNFDDAQSGVKEIFNDRDFNGLLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKRVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNQNKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAVAKVYESSDYLIDTHTAVAYDVYEKYKNKIGDNSATIIA
STASPFKFPKSINEVLDIGHESASDFELINLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaaaaccgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagagttaaaaaacatggattataaagaattagcattctatattatgaaaaaa
tattttgatgattttaatgaagaggaacttaaagagtgtatagataaagcctatgacagt
aagtttcaagatcctcttatagcaccattaaattataaagctggggcatattttttagaa
ctttatcatgggaagacattagcctttaaagatatggctttaagcatacttccatacctt
ttaaaagtttcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggattcgatagtgtagatggcacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaatgcagatggttacacaa
gagggaaaaaatactttcgtagtaggcatagaggggaattttgatgatgctcaaagtgga
gttaaggaaatatttaatgatagggattttaatggattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaagagtaggagaaggagaaagtataaacata
gttgttcctacaggaaactttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatcagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttccatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatctaatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctgttgcaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaataggagataatagtgctactataatagca
tccaccgcaagtccatttaaatttccaaaaagtataaatgaagtattagatataggacat
gagagtgcctcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaaaaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system