KEGG   Clostridium botulinum A3 Loch Maree: CLK_1102Help
Entry
CLK_1102          CDS       T00670                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00260  Glycine, serine and threonine metabolism
cbl00750  Vitamin B6 metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01230  Biosynthesis of amino acids
Module
cbl_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLK_1102 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLK_1102 (thrC)
Enzymes [BR:cbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLK_1102 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP MtrB_PioB
Motif
Other DBs
NCBI-ProteinID: ACA54429
UniProt: B1KS24
Position
1880092..1881573
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKTVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELKNMDYKELAFYIMKK
YFDDFNEEELKECIDKAYDSKFQDPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPYL
LKVSAKKMNITKDIVILTATSGDTGKAALEGFDSVDGTKIVVFYPKDGVSEIQKMQMVTQ
EGKNTFVVGIEGNFDDAQSGVKEIFNDRDFNGLLEEKGCMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKRVGEGESINIVVPTGNFGNILAAFYAKNMGIPVGKLICASNQNKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSCLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAVAKVYESSDYLIDTHTAVAYDVYEKYKNKIGDNSATIIA
STASPFKFPKSINEVLDIGHESASDFELINLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactagaggagaaggaaaaaccgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agctttaaagagttaaaaaacatggattataaagaattagcattctatattatgaaaaaa
tattttgatgattttaatgaagaggaacttaaagagtgtatagataaagcctatgacagt
aagtttcaagatcctcttatagcaccattaaattataaagctggggcatattttttagaa
ctttatcatgggaagacattagcctttaaagatatggctttaagcatacttccatacctt
ttaaaagtttcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggattcgatagtgtagatggcacaaagata
gtagtattttatcctaaggatggagtaagtgaaattcaaaaaatgcagatggttacacaa
gagggaaaaaatactttcgtagtaggcatagaggggaattttgatgatgctcaaagtgga
gttaaggaaatatttaatgatagggattttaatggattattagaggaaaagggatgcatg
ttttcctctgctaattctataaatatagggagattggtaccgcaaatagtatattatgtt
tattcttatgtaaacctacttaaagacaaaagagtaggagaaggagaaagtataaacata
gttgttcctacaggaaactttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaaaattaatttgtgcatctaatcagaataaggtgctaacagactttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttccatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcatgc
cttataaaaaatctaatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcagatgaagatgatacacttaaa
gctgttgcaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaataggagataatagtgctactataatagca
tccaccgcaagtccatttaaatttccaaaaagtataaatgaagtattagatataggacat
gagagtgcctcagattttgaacttattaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaaaaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system