KEGG   Clostridium botulinum A3 Loch Maree: CLK_1393Help
Entry
CLK_1393          CDS       T00670                                 

Gene name
aor
Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLK_1393 (aor)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLK_1393 (aor)
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLK_1393 (aor)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2178681..2180498)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSDVPV
YVNIEDDKIEIKEANHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNEEEAKKVSLEKIKILREDPVAGEGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKVF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHDAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggcaagattttaaggattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctaggggacttggagttaag
actttattagaagaaatagaccctaaaatagatccattatctattgaaaataaacttgtt
atagttactggtcctattactggagctcctatgccaactagtggtagatatatggtagta
acaaaggctcctttaactggtactattgcaatatcaaattctggtgggaaatggggaaca
gaacttaaaaatgcaggatatgatatgataatagtacaaggtaaatcagatgtacctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcaaatcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaataatgaaagagcaaaagtattg
tgtataggacccgcaggagaaaaattatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtagttaaaggctctggaaaagttaaagtagttaatgaagaggaagcaaagaaagtatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtgaaggactacctacttat
ggctctgctgtgcttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcctatacagatgaggcagataaaataagtggagaaacccttacagaggattgt
cttgtaagaaaaaatccatgttatagatgtccaatagcttgtggtagatgggtaaaatta
gatgatggtacagaatgtggaggcccagaatatgaaactttatggtcttttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagccatggagttatatgaaaaagga
tatataaaggatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaagaaaatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctacggtgttccagaattttccatgacagttaaa
aagcaagaactaccggcctatgatccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccagaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcctatgctaaagtattc
catgatttgacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacatgatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagatagttctcatgatacccttccgaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatattatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattgaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system