KEGG   Clostridium botulinum A3 Loch Maree: CLK_1445Help
Entry
CLK_1445          CDS       T00670                                 

Definition
PfkB family kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cbl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbl00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbl00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbl00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbl00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cbl00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2243038..2243961)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELNKKNILTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRDTQKDLLK
YLSSNFKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKDEEDIKEALKYIYRLGAKNILLTLGEKGMYFYNGDKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYESNIEKALKKASATGANVAESSALGTFGKVSEYIQK
IHVKEVV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgctcttccagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcgcctaatggaaaaggagta
aatgtatcactagttttaaatcattattctatagagagtaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattaaataagaaaaatatacttacagaagcc
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggatacccaaaaggatctattaaaa
tacttatcatcaaattttaaaaaaggtgattatttaataataagtggaagtcttcctcaa
agtattcaagaggattactacaatgaaattttagatatatgtatggaaaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataaacctttatta
attaaacctaatgatgaagaagttgaggctatatttggactaagtttaaaagatgaagag
gatataaaagaggcattaaaatatatttataggttaggtgctaaaaatatacttctaacc
ttaggggagaaaggaatgtatttttacaatggagacaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggactcggccttagcagcatttttaagt
gaatggttatatgaatctaatatagaaaaggcacttaaaaaggcatcagctactggtgca
aatgttgctgaatcaagtgcattaggaacttttggtaaagtatcagagtatatacaaaaa
atacatgttaaggaggtagtgtaa

DBGET integrated database retrieval system