KEGG   Clostridium botulinum A3 Loch Maree: CLK_1561Help
Entry
CLK_1561          CDS       T00670                                 

Gene name
eutE
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLK_1561 (eutE)
   00650 Butanoate metabolism
    CLK_1561 (eutE)
Enzymes [BR:cbl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLK_1561 (eutE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(2379090..2380688)
Genome map
AA seq 532 aa AA seqDB search
MENFDKDLRSIQQARDLARLGKVAADKIADYTEEQIDKILRNMVRVAEENAVCLAQMAVE
ETGFGKAEDKTFKNHLAATILYNSIKDMKTIGVINEDEENKLIELAEPVGLVMGIVPSTN
PTSTAIFKAMISIKSRNAIVFAPHPAAAKCTTKAVELMMDAAIEAGAPENIISAVTIPTI
GATNELMKSKEVAIIIATGGPGMVKAAYSSGTPAIGVGAGNSPAYIERTANVEKAVKNII
ASKTFDNGTICASEQSIICEECNHDLVVAEFKKQGGYFMTEEETEKVCKLLFKKGNAMNA
KFVGRSPQVIASAAGFTIPAGAKVLIGRQNGVGEGYPLSFEKLTTVLGFYTVKDWHEACE
LSIKLLQNGIGHTMSIHTEDRDMVMKFARKPASRILVNTGGTQGGTGASTGLNPSFTLGC
GTWGGSSVSENVTPKHLINIKRVAYGIKDCTNLASNDPTFNCIKTAENCHGVQNQFMNMS
PAQIAAAAEVLNKANNCAENTNTCTECSNENTKNEELLDLVNQIVAAMKGAN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattttgataaggatttgcgttcaatacaacaagcgagagatcttgctagactt
ggaaaagtagcagctgataaaattgctgactatactgaagagcaaattgataaaatttta
cgcaatatggtaagagttgcagaagaaaacgctgtttgtttggcacaaatggcagttgaa
gagacaggctttggtaaggctgaagataaaactttcaaaaaccacttagcagctactata
ctttataattcaattaaagatatgaaaactataggtgtaattaatgaagatgaagaaaat
aagcttatagaacttgctgaaccagttggtttagttatgggtatagtaccttcaacaaac
ccaacttctactgcaatttttaaagctatgatttcaataaaatctcgtaatgctatagtg
ttcgcaccacatccagctgctgcaaaatgtacaactaaagcagttgaattaatgatggat
gcagctattgaagctggagcaccagaaaacattataagtgctgtaactatcccaacaatt
ggcgctacaaatgaattaatgaaaagcaaagaagttgctataataatagctacaggtggt
ccaggaatggttaaagctgcttatagttcaggaacaccagctattggtgttggtgcagga
aactctccagcatacattgagagaactgctaatgtagaaaaagctgttaaaaacattatt
gcaagtaagacttttgataatggtacaatctgtgcatcagagcagtcaataatctgtgaa
gaatgtaatcatgacctagttgttgcagaatttaaaaaacaaggtggatacttcatgaca
gaagaagaaactgaaaaagtttgtaagctgttattcaaaaaaggaaatgctatgaatgct
aaatttgttggaagaagtccacaagttatagcaagtgctgcaggattcacaattccagca
ggagctaaagtacttataggaagacaaaatggagtaggagaaggttacccattatctttt
gaaaaacttacaacagttcttggattctatacagtaaaagattggcatgaagcatgtgaa
ttaagtattaaattacttcaaaatggaattggtcacacaatgagcatccatactgaagac
agagatatggttatgaagtttgctagaaaaccagcttctcgtatccttgttaacactggt
ggaactcaaggtggaacaggtgcaagtacaggtcttaatccttcatttactttaggatgc
ggtacttggggaggaagctcagtatctgaaaatgttactccaaagcaccttataaacatc
aaaagagttgcttatggtataaaagattgcacaaatttagcatctaatgacccaactttt
aactgtataaaaactgctgaaaattgtcatggagttcaaaatcaatttatgaatatgagc
ccagcacaaattgcagcagctgcagaagttttaaataaagctaataattgcgctgaaaac
actaatacttgcactgaatgcagtaatgaaaatacaaaaaatgaagaacttttagattta
gttaatcaaatagttgccgctatgaagggggcaaactaa

DBGET integrated database retrieval system