KEGG   Clostridium botulinum A3 Loch Maree: CLK_1896Help
Entry
CLK_1896          CDS       T00670                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00230  Purine metabolism
cbl01100  Metabolic pathways
Module
cbl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLK_1896 (gmk)
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLK_1896 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 Cytidylate_kin AAA_28 AAA_22 dNK RsgA_GTPase ABC_tran AAA_16 ADK Rad17 AAA_17 MMR_HSR1 ATP-synt_ab AAA_29
Motif
Other DBs
NCBI-ProteinID: ACA53820
UniProt: B1KX64
Position
complement(2712717..2713346)
Genome map
AA seq 209 aa AA seqDB search
MAKKGLLIVISGPSGAGKGTICKELLKKEDLWVSVSATTRSPRKGEENGVHYFFLNKDEF
NERIEEDDFLEYAKVHQNLYGTPKSSVLEKINNGNNVILEIDIQGALKVKETYPEGIFIF
ILPPSMEELKNRIINRGSETAETLMIRFKAAYKEINYVSKYNYAVVNDTVEDAVNKVRSI
ILAESCRVDRMKDTILASKEEFIHEQFYD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaggacttcttatagttatttctggaccatctggtgcaggaaaaggaact
atatgcaaagaacttttaaaaaaggaagacctatgggtatcagtttctgccaccactaga
tctccaagaaagggagaggaaaacggagtacattattttttcttaaataaagatgaattt
aatgaaaggatagaggaagatgattttttagaatatgctaaagttcatcaaaacttatat
ggaactcctaaatctagtgttttagaaaagattaataatggtaataatgtaatattagag
atagatattcaaggagccttaaaagtaaaagaaacttatccagaaggaatatttatattt
atattgcctccttctatggaggaattaaaaaatagaataataaatagaggcagtgaaaca
gcagaaactttaatgataagatttaaagctgcttacaaagaaataaattatgtatcaaaa
tataattatgcagtagtaaatgatacagtggaggacgcagttaataaggtaagaagtatt
atattagcagaaagctgtagagttgatagaatgaaggatacaatattagcatcaaaggag
gaatttattcatgagcaattctatgattaa

DBGET integrated database retrieval system