KEGG   Clostridium botulinum A3 Loch Maree: CLK_2169Help
Entry
CLK_2169          CDS       T00670                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLK_2169 (glpK)
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CLK_2169 (glpK)
Exosome [BR:cbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLK_2169 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3006104..3007600)
Genome map
AA seq 498 aa AA seqDB search
MEKYIMSLDQGTTSSRCIIFNKKGEVVSVAQKEFTQIYPKAGWVEHDPLEIWGKQAGVAG
EALNIARISPEQIAGIGITNQRETTVVWNKRTGMPVYNAIVWQCRRTAGYCDELREKGID
KTIKEKTGLMLDAYFSATKIKWILDNVEGARELAEKGDLLFGNIDTWLIWNMTKGKIHVT
DYTNASRTMLFNIHELKWDEELLEILDIPKSMLPEVKPSSCVYGETDEILFGVSIPISGD
AGDQQAALFGQTCFNAGMAKNTYGTGCFLLMNTGEKAVDSKNGLLTTIAVGIDGKVEYAL
EGSIFIGGAVIQWLRDELRMVKTAQETEKYATEVEDNNGVYLVPAFVGIGAPYWDSYARG
TILGLTRGAKKEHIIRAALESMAYQTHDVLKAMEEDSGIELKALKVDGGACQNNFLMQFQ
SDILGVEVDRPEVVETTALGAAYLAGLAVGYWKDRNEISQNWAISRSFAPAMEDEKKEKL
IKGWHKAVTKAMDWEERE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatataatgtctttagatcaaggaactactagttcaagatgtataatattt
aataaaaaaggtgaagtagtaagtgttgctcaaaaggaatttacacaaatatatcctaaa
gcaggatgggtagaacatgatccactagaaatatggggaaaacaagcaggggtagcagga
gaagcattaaatatagctagaatttctccagaacaaatagcaggtataggtataactaat
caaagagaaactacagtagtttggaataaaagaacaggaatgccagtatataatgctata
gtatggcaatgtagaagaacagctggttattgtgatgaattaagagaaaaaggtatagat
aaaactataaaagaaaaaacaggtctaatgttagatgcttatttttcagcaacaaaaata
aaatggatattagataatgtagagggagctagagaattagcagaaaaaggtgatttatta
ttcggaaatatagatacctggttaatctggaatatgacaaaggggaaaattcatgtaaca
gattatactaatgcttcaagaactatgttatttaacatacatgaattaaaatgggatgaa
gaattattagaaatacttgatattcctaaatctatgcttccagaagtgaaaccatctagc
tgtgtatatggtgaaacagatgaaatattgttcggggtatcaattccaatatctggagat
gcaggagatcaacaagcagctttgtttggacaaacttgctttaatgcaggtatggctaaa
aatacttatggtacaggttgtttcttgttaatgaatacaggagaaaaagcagtagattct
aaaaatggattattaactactatagctgtgggtatagatggaaaagttgaatatgcttta
gaaggaagtatatttataggtggagcagtaattcaatggctaagagatgagcttagaatg
gtaaaaactgctcaagaaacagaaaaatatgccacagaagtagaagataataatggagtt
taccttgtgccagcttttgttggaataggtgcaccatactgggattcttatgcaagagga
actatattgggccttacaagaggcgctaaaaaagaacatataataagagccgcattagaa
tctatggcataccaaactcatgatgttttaaaggctatggaagaggactcaggtatagaa
ttaaaagcattaaaagtagatgggggagcttgtcaaaataatttcttaatgcaatttcaa
tctgatatattaggtgtagaagtagatagaccagaagtagtagagactacagcattagga
gcagcttatcttgcaggacttgcagtaggatattggaaggatagaaatgaaatatcacaa
aactgggcaatttcaagaagctttgctccagcgatggaagatgaaaagaaagaaaaactt
ataaaaggatggcataaggcagtaacaaaagcaatggattgggaagaaagagaataa

DBGET integrated database retrieval system