KEGG   Clostridium botulinum A3 Loch Maree: CLK_2507Help
Entry
CLK_2507          CDS       T00670                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLK_2507 (galU)
   00052 Galactose metabolism
    CLK_2507 (galU)
   00500 Starch and sucrose metabolism
    CLK_2507 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CLK_2507 (galU)
Enzymes [BR:cbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLK_2507 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3380629..3381525)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNK
RAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFV
GNEPFAVMLGDDVVYSDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIVKGMFIEDR
VYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKE
AMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNANFVKYLQQLKNNEEFTALFKTE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggccataattcctgcagcaggattgggaacaagatttttacctgca
actaaagctcaacctaaagaaatgttacctatagttgataaaccaactatacaatatata
atagaagaggctgtaaaatccggtatagaacaaatattaataataactggaagaaataaa
agagctatagaagatcattttgataaatctgtagaattggaaaaggaattagaagaaaaa
ggtaaagctgaaatgctttctatggttaaagatatatctaatatggctgaaatatattat
ataagacaaaaagaacctaaaggattagggcatgctataagttgtgctaaaacttttgtt
ggcaatgaaccttttgcagtaatgttaggagacgatgtagtctatagtgataaaccatgc
ttgaagcagcttataaaatgctacaatgaatatcaaacaactatagtaggtgtacaagaa
gtaccagaggaagatgtacataaatatggtattgtgaaaggtatgtttatagaagataga
gtatataaaataaaagatttagtagaaaaaccacctaaggaagaagcaccatctaatatg
gctatattagggagatatattataagtcctgctatatttgatattttagaaaatacaaaa
ccgggtaaaggtggagaaatacagcttacagatgcattgagaacattgattaataaagag
gccatgtatgcatataattttgagggtagaagatatgatgttggagataaactaggattt
cttcaggctactgtagagtatgcactaagaagagaaaaattaaatgcgaatttcgtcaaa
tatctacaacaattgaaaaataatgaagaatttacagcgctatttaaaactgaataa

DBGET integrated database retrieval system