KEGG   Clostridium botulinum A3 Loch Maree: CLK_2760Help
Entry
CLK_2760          CDS       T00670                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLK_2760
  Amino acid metabolism
   00300 Lysine biosynthesis
    CLK_2760
Enzymes [BR:cbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CLK_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
complement(3650113..3651504)
Genome map
AA seq 463 aa AA seqDB search
MEINKIIEELKDDLIDSTAELVKIKSIEGEAKEGKPYGEGVASALEKALEISEKLGFKTV
NVDGYVGYAEYGEGDEYVGVLGHLDLVPEGDGWKYPPYGAEIHDGKMYGRGTTDDKGPIM
AALYGLKAIKESKLPLSKKVRVLFGTNEETGSKEIEHYLEKEKPPVLGFTPDAEYPIIYA
EKGITIFDVVKKLEIKSSKAIKLKYIKGGEASNMVPDYCEAGIECPDTDMIIRSLEYCAN
RNGIELTAEEKGGLVVIKSFGLSAHGSTPEIGKNAIMQMFKFLAELPLGHCDELQFIRFF
NNNVGNETDGKTFDVELEDEPSGKLSFNVGTISMENNEIRMSLNLRYPVTYKSKDLMEKF
NKKIDGTGIKVENFEDQKPLYFDAEHQLIKSLQKVYKEQTGKEPELLAIGGGTYAKEMPN
IVAFGPLFPGEPDVIHKKNEYIELENLVLNAKIYGHAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggagataaataaaataatagaagagctaaaagatgatcttatagactctactgcagaa
ttagttaaaattaagagtatagaaggggaagcaaaggaaggtaaaccttatggggaaggc
gtagccagtgctttggaaaaagcattagaaataagtgaaaagttaggttttaaaactgta
aacgtagatggatatgttggatatgctgaatacggtgaaggtgatgaatatgtaggtgtt
ttaggtcatttggatctagtaccagaaggagatggatggaagtatccaccttatggagca
gaaatacatgatggaaaaatgtatggtagaggaactacagatgacaaggggcctataatg
gcagcactttacggtttaaaagccataaaagaatcaaaacttcctttatctaaaaaggtt
agagtcttgtttgggacaaatgaagaaacaggttctaaagaaatagaacattatctagaa
aaggaaaaaccgccagtacttggatttactccagatgctgagtatccaataatctatgct
gaaaaaggaattacaatatttgatgtagtaaaaaaattagaaataaaaagtagcaaagct
attaaattaaaatatattaaaggtggagaagcatctaatatggtgccagattattgtgaa
gctggtatagaatgtccagatacagatatgataataagatctttagagtattgtgctaat
agaaatgggatagaattaacagcagaagaaaagggtggtttagtagtaattaaatctttt
ggactatccgctcatggaagtacaccagagattggtaagaatgctataatgcaaatgttt
aaatttttagcagaacttccattaggtcattgtgatgaattacaattcataagatttttt
aataataatgtaggaaatgaaactgatggtaaaacttttgatgtagagctagaagatgaa
ccatcaggtaaattaagttttaatgtaggaactatttctatggaaaataatgaaataaga
atgtcattaaatttaagatatcctgtaacatataaatcaaaagatcttatggaaaagttc
aataaaaagatagatggaacaggaataaaagtagaaaattttgaggatcaaaaaccttta
tattttgatgcagaacaccaattaataaaatcattacaaaaggtatataaagaacaaaca
ggaaaagaaccagaattactagctataggtggaggaacttatgcaaaagaaatgcctaat
atagttgccttcggaccacttttccctggagaaccagatgtaattcataaaaaaaatgaa
tatatagaactagaaaatttggtattaaatgccaaaatatacgggcatgctatatatgaa
ttagccaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system