KEGG   Clostridium botulinum A3 Loch Maree: CLK_3167Help
Entry
CLK_3167          CDS       T00670                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
34368..34964
Genome map
AA seq 198 aa AA seqDB search
MDFYPIAIEKLIEEFAKLPGIGYKTAQRLTLYVLNLPKEEVKEFSEALVKARGTIKYCSV
CGNFTDKDPCAICSNPNRNKSIICVIEQPKDIMSMEKIREYNGVYHVLHGNISPMAGRGP
EDIKLKELIRRIDGSVNEVIVATNPNVEGEATAMYISKILKPLGVKVTRIAHGVPVGGDL
EYADEVTLAKALEGRIEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttggatttttatcctatagctatagaaaaattaatagaagagttcgctaaattaccgggt
ataggttataaaacagctcaaagacttactctatatgtactaaatttacctaaagaagag
gtaaaggaattctcagaggctttagtaaaagctagaggtacaattaaatattgttctgta
tgtggtaattttacagataaagatccttgtgctatatgtagtaatcctaataggaataaa
tctattatttgtgtaatagaacaacctaaagatataatgtctatggaaaaaataagagaa
tataatggagtatatcatgtattacatgggaatatatctcctatggcaggaagaggtcct
gaagacataaaattaaaagaattaataagaagaatagatggtagtgtaaatgaagttata
gttgctactaatcctaatgtagaaggagaagcaacagctatgtatatatctaaaatatta
aaacctctaggagttaaagttacaagaattgcccacggagtaccagtaggtggggattta
gagtatgcagatgaggttactttagctaaagctttagaaggaagaatagaattataa

DBGET integrated database retrieval system