KEGG   Clostridium botulinum A3 Loch Maree: CLK_3347Help
Entry
CLK_3347          CDS       T00670                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLK_3347
Enzymes [BR:cbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLK_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195358..197592
Genome map
AA seq 744 aa AA seqDB search
MQEIQGFIEDILFKNDENGYVVAKIRKKKELITIVGCMPYITEGQNLKLKGEWVIHPQFG
NQFKVEICEEIVPDTVAGIERYLSSGIISGIGPVTAKKIVKKFGEETLNILDNNIERLTD
IEGIGKKKIEIIYDSYIKQNEVRNIMMFFQNYGVTPNQCMKVYKRFGENSISIVKENPYV
LTEEIRGIGFKTADKIARSLGIASNSPFRIQSGINYIINGFCSLGNTYMPLEKLISEAMD
ILGVREEEIHENIYNNIAENKLKIEKVKEQSCVFTLPYYYCELGVTKKILSLSLSQYDNL
NINIEDEVLNFEKNNNIKFHDSQREAIKGALENGVEIITGGPGTGKTTIINCITEIFEKA
NMKVYMAAPTGRAAKRMSETTGREAKTIHRMLEMGVSDDDTEEVFSKGEETPLECDVVII
DEASMIDIILMNTLLKAIALGTRIIIVGDVDQLPSVGPGNVLRDLIESKCVKVVRLKEIF
RQSKESMIIVNAHRINDGEMPIINKKDKDFYFIECSEPKKIVNTLLELSNRRLPKFNKSW
HKIHDIQILSPMRKGVLGVSSLNKELQSVLNPKNDSKKEMEFKDYIFRVGDKVMQTKNNY
SLKWTRASGEGEAEGLGIFNGDVGYIEDIDEEKETIQILFDNERRVIYENLYLDEIDLAY
AVTIHKSQGSEFPVVIMPAFKGPPLLMNRNLLYTGITRAKRLVVLVGSLKAINFMVQNDK
IFERYSLLKWRISNVLDNEIINEE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaatacagggatttatagaggatatactttttaaaaatgatgaaaatgggtat
gtagtggcaaaaataagaaagaagaaagagcttataaccatagtcggatgtatgccctac
ataacagaaggacaaaacttaaaattaaaaggtgaatgggtaattcatccacaatttggt
aatcaattcaaagtagaaatatgtgaagaaatagtacccgatactgtagctggtatagaa
agatatttatcctcaggaatcatatcaggtataggcccagtgactgcaaaaaaaattgtg
aaaaaatttggagaagaaacattaaatatattagacaataatatagaaagattaacagat
atagagggaataggaaaaaagaagatagaaataatatatgattcctatataaaacaaaat
gaagtgcgaaatataatgatgttttttcaaaattacggggttacacctaaccaatgcatg
aaagtttataaaagatttggagaaaattctatatcaatagttaaagagaatccatatgta
cttacagaagaaataagaggaataggttttaaaacagcagataaaatagctagaagctta
ggaatagcctctaattcaccctttagaattcagagtggaataaattatataataaatgga
ttctgtagtttaggaaatacttatatgcctttagagaagcttataagcgaggctatggac
atattaggggtaagagaagaagaaatacatgaaaatatatataataatatagcagaaaat
aaattaaagatagaaaaagtaaaagaacaaagctgtgtttttactctaccgtattattat
tgcgaattaggagttacaaaaaaaatacttagtttatctttgtcacaatatgataattta
aatataaatatagaagacgaggtattgaattttgaaaaaaataataatataaaatttcat
gattctcaaagagaagctataaaaggtgccttagaaaatggagtagaaataataacagga
ggccctggtacaggaaaaacaactattattaattgtataacagagatatttgaaaaagct
aatatgaaagtttatatggcagcacctacaggaagagcggctaaaagaatgtctgaaacc
acaggtagagaagctaaaacaatacataggatgttagaaatgggtgtatctgatgatgac
acagaagaagttttttctaaaggtgaagaaactcctttagaatgtgatgtagtaataata
gatgaagcttccatgatagatataatattaatgaatacactgttaaaggccatagcttta
ggtacaagaataataatagttggggatgtagatcaacttccttcagtaggtccaggaaat
gtattaagagatttaatagaaagtaagtgtgtaaaggtagttagattaaaggagatattc
aggcaatctaaagaaagcatgattatagtaaatgcccatagaataaatgatggagagatg
ccaattataaataaaaaagataaagatttttattttatagaatgtagtgaacctaaaaaa
atagttaatacattattagaactttcaaatagaagattacctaaatttaataaaagctgg
cataaaattcatgatatacaaatactatctccaatgagaaagggagttctaggagtttct
agcttgaataaggaattacagtctgttttaaaccctaaaaatgattcaaaaaaagaaatg
gaatttaaggattatatatttagagtaggagataaagttatgcaaaccaaaaacaactac
tctttaaagtggaccagagcaagtggcgagggggaagcagaagggttaggaatatttaat
ggagatgtaggatatatagaggatatagatgaagaaaaagaaacaattcagattttattt
gataatgaaagaagagtaatatatgaaaatttatatttagatgagatagatttagcttat
gctgtgactattcataaaagtcaaggtagcgaatttccagtagtaattatgccagctttt
aaaggtccaccacttctaatgaatagaaatttattgtatacaggaataacaagagcaaaa
aggcttgttgtcttggtaggatctttaaaagctattaattttatggtacagaatgataaa
atttttgaaagatactctcttttaaagtggcgtataagtaatgttttagataatgaaatt
ataaatgaagaataa

DBGET integrated database retrieval system