KEGG   Clostridium botulinum A3 Loch Maree: CLK_3410Help
Entry
CLK_3410          CDS       T00670                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
cbl00010  Glycolysis / Gluconeogenesis
cbl00051  Fructose and mannose metabolism
cbl00562  Inositol phosphate metabolism
cbl01100  Metabolic pathways
cbl01110  Biosynthesis of secondary metabolites
cbl01120  Microbial metabolism in diverse environments
cbl01130  Biosynthesis of antibiotics
cbl01200  Carbon metabolism
cbl01230  Biosynthesis of amino acids
Module
cbl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLK_3410 (tpiA)
   00051 Fructose and mannose metabolism
    CLK_3410 (tpiA)
   00562 Inositol phosphate metabolism
    CLK_3410 (tpiA)
Enzymes [BR:cbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLK_3410 (tpiA)
Exosome [BR:cbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLK_3410 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLK_3410 (tpiA)
  Exosomal proteins of melanoma cells
   CLK_3410 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA56414
UniProt: B1KTJ6
Position
268796..269542
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEQREGNVTEKVLEGQIKVDLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKSMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFSAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcgggaaactggaaaatgaacaaaactgtaaaagaggcagta
gaattagttaaagaattaaagccacttgttaaagatgcaaaatgtgatgtagttgtatgt
ccgacttatgtatgtcttccagctgtattagaagaagttaaaggaagtaatataaaagta
ggtgctcaaaacatgcattttgaagaaagcggagcttatacaggtgaaatatcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagcatttgagcataactta
attccaatagtttgttgcggagaaagcttagaacaaagagaaggaaacgtaacagaaaaa
gttttagaaggacaaataaaagttgacttaaaagaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgctacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaatctatgtatggtgaagat
gttgcaagtaaagtaagaatccaatatggtggttctgttaaacctggtactatcaaagct
caaatggctaaagaagagattgatggtgctctagtaggtggcgcaagcttaaaagcagaa
gatttttcagctatagtaaatttttaa

DBGET integrated database retrieval system