KEGG   Clostridium botulinum A3 Loch Maree: CLK_3410Help
Entry
CLK_3410          CDS       T00670                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbl  Clostridium botulinum A3 Loch Maree
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cbl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbl01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbl00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbl00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cbl00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
268796..269542
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEISPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEQREGNVTEKVLEGQIKVDLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKSMYGEDVASKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFSAIVNF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcgggaaactggaaaatgaacaaaactgtaaaagaggcagta
gaattagttaaagaattaaagccacttgttaaagatgcaaaatgtgatgtagttgtatgt
ccgacttatgtatgtcttccagctgtattagaagaagttaaaggaagtaatataaaagta
ggtgctcaaaacatgcattttgaagaaagcggagcttatacaggtgaaatatcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagcatttgagcataactta
attccaatagtttgttgcggagaaagcttagaacaaagagaaggaaacgtaacagaaaaa
gttttagaaggacaaataaaagttgacttaaaagaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgctacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaatctatgtatggtgaagat
gttgcaagtaaagtaagaatccaatatggtggttctgttaaacctggtactatcaaagct
caaatggctaaagaagagattgatggtgctctagtaggtggcgcaagcttaaaagcagaa
gatttttcagctatagtaaatttttaa

DBGET integrated database retrieval system