KEGG   Clostridium botulinum F 230613: CBF_0384Help
Entry
CBF_0384          CDS       T01865                                 

Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CBF_0384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBF_0384
   00620 Pyruvate metabolism
    CBF_0384
   00650 Butanoate metabolism
    CBF_0384
  Lipid metabolism
   00071 Fatty acid degradation
    CBF_0384
  Amino acid metabolism
   00350 Tyrosine metabolism
    CBF_0384
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CBF_0384
   00626 Naphthalene degradation
    CBF_0384
Enzymes [BR:cbm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CBF_0384
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CBF_0384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404721..407309
Genome map
AA seq 862 aa AA seqDB search
MKITTTEELIRKIEKIKEAQKIYSTYSQDKVDKIFKAAAIAANKERIKLAKMAVEETGMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVIEKDEAFGLTKIAEPIGVIAAIVPTTNPTSTA
IFKALIALKTRNGIIFSPHPRAKKSTIMAAKIVLDAAVQAGAPKEIIGWIDEPTLELSNA
VMSNSNLVLATGGPGMVKAAYSSGKPAIGVGPGNVPAIIHETADIKMAVSSVVLSKTFDN
GMICASEQSVIVMNSIYEEVKKEFVIRGAYVLNKEEIEKVKKIILVNGNVNAKIVGQTPQ
KIGEMAGIKVPDWAKLLVGEVQSVELEEPFSHEKLSPVLAMYKVKTYEEALTKAERLVEL
GGFGHTSSLYINTIKCKEEVEKFSNNMKTGRTIINMPSAQGGIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLLNIKNVAERRENMLWFRVPEKVYFKYGCLPIALKELKRMNKKKA
FIVTDKVLYELGVAKKATDVLDEIGINYKVFFDVAPDPTLETAKKGAKEMVDFNPDTIIA
IGGGSAMDAAKIMWVMYEHPEVEFEDLAMRFMDIRKRVYEFPHMGDKAMMISVATSAGTG
SEVTPFAVITDEKTGVKYPLADYELTPDMAIVDADLMLNMPKGLTAASGIDALTHAVEAY
VSVMASEYTDGLCLEAIKTIFEYLPKAYKEGAQDIEAREKMAHASTIAGMAFANAFLGVC
HSMAHKLGSMHHVPHGIANALLINETIKFNSEDMPRKQTAFPQYKYPNAKAKYANIADYL
SLGGKTPEEKVELLIKAIDKLKAEVNIPTSIEEAGVSKDKFFKTLDEMSEQAFDDQCTGA
NPRYPLISEIKEMYTNVFSTKK
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaccactactgaggaactaataagaaaaattgaaaaaatcaaagaggcacaa
aagatttattccacatattctcaagataaggtagacaaaatatttaaagcagcagctata
gcagctaacaaagaaagaataaaacttgcaaaaatggcagtagaagaaacgggcatgggt
attgtagaagataaagttataaaaaatcattttgcatctgaatatatttataacaaatat
aaagatgaaaaaacctgtggtgtaatagaaaaggatgaagcctttgggttaacaaaaatt
gcagaaccaataggtgttattgcggcaatagttccaacaactaatccaacctcaacagct
attttcaaagctttaatagctttaaaaactagaaatggtataattttttcacctcatcca
agagctaaaaaatctacaataatggcagctaagattgttttagatgcagcagtacaagca
ggggcgccaaaagaaataataggttggatagatgaacctaccttagaattgtctaatgca
gtaatgagtaattcaaatctagttcttgcaacaggtggaccaggtatggttaaagcggca
tactcttcaggaaagccagctataggagtaggacctggaaatgtaccagctataatacac
gaaacagcagatattaaaatggctgtaagctcagtggtactttctaaaacttttgataat
ggtatgatttgtgcatcagaacaatcagtaattgtaatgaatagcatatatgaagaagta
aaaaaagaatttgtaattagaggagcctatgtattaaataaagaagagatagaaaaagtt
aagaaaataattttagttaatggaaatgtaaatgctaaaatcgttggtcaaacaccacaa
aagataggtgaaatggccggaataaaagttccagattgggctaaacttttagttggagaa
gttcaatctgtagaattagaagaaccattctctcacgaaaaactatcaccagttttagca
atgtataaagttaaaacttatgaagaggctttaactaaagctgaaagattagtagaatta
ggaggatttggacatacatcttcattgtatataaacacaataaaatgcaaagaagaagta
gaaaagttctcaaataatatgaaaacaggaagaacaattataaatatgccatcagcccaa
ggtggtataggtgatatatataactttaaattagcaccatctctaactcttggttgtgga
tcctggggtggaaactcagtatcagagaatgtaggaccaaaacacttattaaatatcaaa
aatgtagctgagaggagagagaatatgctttggtttagagtaccagaaaaagtttacttt
aaatatggatgtcttccaatagctttaaaagaattaaaaagaatgaacaagaaaaaggca
tttatagttacagataaagtattatatgaattaggagttgctaaaaaagcaacagatgtg
ttggatgagataggaataaattataaggtattctttgatgtagcaccagatccaacttta
gaaacagcaaaaaaaggtgcaaaagaaatggtagattttaatcctgatacaataatagct
ataggcggaggatctgctatggatgctgctaaaataatgtgggtaatgtatgaacatcca
gaagtagaattcgaagatttagctatgagatttatggatataagaaaaagagtatatgag
ttcccacatatgggagataaagcaatgatgatatcagtagctacttcagcaggtactggt
tcagaagtaactccttttgctgttataactgatgaaaaaacaggtgtgaaatatccacta
gcagattatgaattaactccagatatggctatagtagatgcagatttaatgcttaatatg
ccaaagggattaactgctgcatcaggaattgatgcattaactcatgcagtagaagcttat
gtatcagttatggcatcagagtatacagatggactatgtttagaggctataaaaaccata
tttgaatatctaccaaaagcttataaagaaggagcccaagatatagaagcaagagaaaaa
atggctcatgcatcaactatagcaggtatggcttttgcaaatgccttcttaggagtatgc
cactctatggctcataaattaggatctatgcatcatgtaccacatggtatagctaatgct
ttattaataaatgaaacaattaaatttaattctgaggatatgccaagaaagcaaactgct
ttcccacaatataaatatccaaatgctaaggctaaatatgctaatatagcagattattta
tcattaggtggaaaaactccagaagaaaaagttgagctattaataaaagctatagataaa
ttaaaagcagaagtaaatattccaacctctatagaagaggcaggggtatcaaaggataaa
ttctttaaaactttagatgagatgtccgaacaagcttttgatgatcaatgtacaggagct
aatccaagatacccattaataagtgaaataaaagaaatgtatactaatgtttttagtacc
aaaaaatag

DBGET integrated database retrieval system