KEGG   Clostridium botulinum F 230613: CBF_0934Help
Entry
CBF_0934          CDS       T01865                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBF_0934
Enzymes [BR:cbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CBF_0934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006446..1007867
Genome map
AA seq 473 aa AA seqDB search
MSGLAKDFLWGGATAANQCEGGYLEGNRGLGTVDVIPAGANRRAVMQGKMHYNNLQEDSY
FPSHEAIDMYHNYKEDIALFAEMGFKCYRFSFSWSRIFPTGKEQEPNEEGLAFYEKFIDE
LLKYNIEPVVTICHFDVPLVLEQEYGSWRSRKLIDAYLRYCEAIFKRFNGKVKYWITFNE
INMLMHLPFMGAGIMFKEGENELEVKYQAAHNELVASALATKLAKEINKDNKIGCMLAAG
QFYPYTCKPEDVLEAMEKDKNNYFFIDVQSRGEYPSYAKKFLERNNIKIEMQPEDEKILR
KNTVDFIAFSYYTSRLASSDPNAGEKSAGNVITSLKNPHLKSSKWGWQIDPIGLRITMNS
LYDRYQKPLFIVENGLGAVDVLSEDGTVDDDYRIAYLENHIKNMIDAVELDGVELLGYTT
WGCIDLVSASTGEMKKRYGFIYVDKDNDGHGTLKRYKKKSFYWYKNVIKNNRL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattagcaaaggattttttatggggcggagctacagcagctaaccaatgcgaa
ggtggttatttagaaggaaatagaggattaggaactgtggacgttattccagcaggagca
aatcgtagagctgttatgcaaggaaagatgcattataataatttacaagaggattcttat
ttcccatcacatgaagcaatagatatgtatcataactacaaggaagatatagcattattt
gcagaaatgggctttaaatgttatcgtttctcattttcatggtcaagaattttcccaaca
ggaaaggaacaagaaccaaatgaggaaggtttagcattttatgaaaaatttattgatgaa
ctattaaaatataatattgaaccagtagttactatatgtcactttgatgtacctcttgta
ttggagcaggaatatggttcatggagaagtagaaaattaatagatgcatatcttagatat
tgtgaagcaatatttaaaagatttaatggaaaagtaaagtattggataacttttaatgaa
ataaatatgcttatgcatttaccctttatgggagctggaataatgtttaaggaaggggaa
aatgagctagaagtaaaatatcaagcagctcataatgaattagtggcatcagctttagct
acaaaattagcaaaggaaattaataaagataataaaataggatgcatgttagcggcaggg
caattctatccatatacttgtaagccagaggatgttctagaggctatggagaaagataaa
aataattatttcttcatagatgtacaatctaggggagaatatccgagctatgctaaaaaa
tttttagagagaaacaatataaaaatagaaatgcagccagaagatgagaagattttaagg
aagaatactgttgattttattgcatttagttactatacttcaagacttgcaagtagtgac
ccgaatgcaggagaaaaatcagctggtaatgtaataacatcattaaaaaatccacattta
aaatctagtaaatggggatggcaaatagatccaataggtcttagaattacaatgaattca
ctttatgatcgttatcaaaaaccgctattcattgtggaaaatggcttaggtgctgttgat
gttttaagtgaagatggtactgtagatgatgattacagaattgcttatcttgaaaatcat
ataaaaaatatgattgatgcagttgaattagatggtgttgaactattaggatatacaact
tggggatgtattgatttggttagtgcatcaacaggggaaatgaagaagcgatatggtttt
atatatgtggataaggataatgatggtcatggaactttaaagagatacaagaaaaaatct
ttctattggtacaaaaatgttattaaaaataatagactataa

DBGET integrated database retrieval system