KEGG   Clostridium botulinum F 230613: CBF_0982Help
Entry
CBF_0982          CDS       T01865                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CBF_0982
Enzymes [BR:cbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CBF_0982
Exosome [BR:cbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBF_0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057706..1058680
Genome map
AA seq 324 aa AA seqDB search
MFRRHRRLRENEAIRAMVRETVIREEDFIYPMFVVEGENIKEEISSLPGNYHYSIDRLEE
LVEEVKKSGIKGIMIFGVPDHKDECGSAAFDDNGIVQKGIRRLRELMPELYIVADVCMCQ
YTSHGHCGIIHGHNVDNDESLKYLAKISLSYAKAGADMIAPSDMMDGRVYAIRKILDENN
FKHVGIMAYSAKYCSAFYGPFREAANSAPQFGDRKTYQMDPANGREAMLEIEDDINEGAD
IVMVKPALPYLDVIRMAKDRFEFPLAAYNVSGEYAMVKAAAKQGLIDERRVALEMLTSIK
RAGADIIITYYAFEASAWLKEDRK
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacacagaagattaagagagaatgaagcaataagagctatggtaagagaa
acagtgattagagaagaggattttatatatccaatgtttgtggtagaaggagaaaatatt
aaagaagaaatatcttcactgccaggaaattatcattattctatagatagattagaagaa
ttagtagaagaagtaaagaaatcaggcataaaaggcataatgatatttggagtaccagat
cataaagatgaatgtggctctgcagcctttgatgataatggaatagttcaaaagggtata
agaagattaagagaattaatgccagaactatatatagttgcagatgtatgtatgtgccaa
tatacaagtcatgggcattgcggaataattcatggtcataatgtagataatgatgaatca
ttgaaatatttagcaaaaatatctttatcctatgcaaaagctggagcagatatgatagca
ccttcagatatgatggatggaagagtttatgctataagaaaaatattagatgaaaataat
tttaaacatgtaggcataatggcttatagtgcaaaatattgttcagctttctatggccct
ttcagagaagcagccaattcagcaccacaatttggagacagaaaaacttatcaaatggat
ccagcaaacggaagagaagcaatgcttgaaatagaagacgatataaatgaaggtgcagat
atagtaatggtaaagccagctttaccatacttagatgttataagaatggcaaaggataga
tttgaatttccgttagcagcttacaatgtaagtggagaatatgctatggtaaaagcagca
gctaaacaaggattaatagatgaaagaagagtagccctagaaatgctaacatcaataaaa
agagcaggagcagatataataataacttattatgcatttgaagcaagtgcttggttaaaa
gaagacagaaaatag

DBGET integrated database retrieval system