KEGG   Clostridium botulinum F 230613: CBF_1258Help
Entry
CBF_1258          CDS       T01865                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBF_1258
Enzymes [BR:cbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CBF_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1350388..1351833
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGDEKEANEKGLQFYDDVFDECLKYDIHP
IVTLSHYETPLHLSKVYDGWKSREMIGFFNKYVCTVFNRYKNKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWDTLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIREGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELEDGTKTVLDDYRISYLRDHLIEVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcttggtcaagaatatttccaatgggggatgaaaaagaagcaaacgag
aaaggactacaattttatgatgatgtttttgatgagtgcttaaagtatgacatacaccca
atagtaacattgtcccattatgagactccattgcatttatctaaagtttacgatggatgg
aaaagtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcgatat
aaaaataaagtaaaatattggttaacttttaatgaaattaattcaattactcatgcacca
tttttaagcggtggaatttatacaccaatagaaaaattaagtaagcaagaaatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgtcatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggatacacttaataaagaaagagagaattttttcttttcagatatt
caagttcgtggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggaaggtgagggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattgtatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgaactagaagatggaacaaaa
acagtattagatgactatagaatttcatatttaagagatcatttaattgaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttggggatgcattgatttggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatggaacagggacattagaacgctataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcactatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system