KEGG   Clostridium botulinum F 230613: CBF_1692Help
Entry
CBF_1692          CDS       T01865                                 

Gene name
acoC
Definition
(GenBank) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbm  Clostridium botulinum F 230613
Pathway
cbm00010  Glycolysis / Gluconeogenesis
cbm00020  Citrate cycle (TCA cycle)
cbm00620  Pyruvate metabolism
cbm01100  Metabolic pathways
cbm01110  Biosynthesis of secondary metabolites
cbm01120  Microbial metabolism in diverse environments
cbm01130  Biosynthesis of antibiotics
cbm01200  Carbon metabolism
Module
cbm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBF_1692 (acoC)
   00020 Citrate cycle (TCA cycle)
    CBF_1692 (acoC)
   00620 Pyruvate metabolism
    CBF_1692 (acoC)
Enzymes [BR:cbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBF_1692 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADF99406
Position
1821413..1822723
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VDEGTVVECLKPVAIIGDKDEDISNLLKESLQDSKENEVEKEVKESKEEIKDNRKIKKGE
RTKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKMAKDL
VVNLEDIKKDGRIMKDDILEFIQKSIPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKDEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtggatgaaggtacagtagttgaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaaaggaatctttacaagatagtaaggaaaatgaggtagaa
aaagaagttaaagaatctaaggaagagataaaagataataggaaaattaaaaaaggagaa
agaacaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatggccaaagattta
gtcgttaatttagaagatataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctattccttctgtaggagaagatttaatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggacatgactaatttaaaaaggttaaaggaacaaattaaa
gatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagagggagatgaaatgatttttagaaattattca
aatattggagtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagtggtagagaatggagaaatagtgataaaacctctt
atgagtttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattgtag

DBGET integrated database retrieval system