KEGG   Clostridium botulinum F 230613: CBF_2045Help
Entry
CBF_2045          CDS       T01865                                 

Gene name
pfkB
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBF_2045 (pfkB)
   01230 Biosynthesis of amino acids
    CBF_2045 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBF_2045 (pfkB)
   00030 Pentose phosphate pathway
    CBF_2045 (pfkB)
   00051 Fructose and mannose metabolism
    CBF_2045 (pfkB)
   00052 Galactose metabolism
    CBF_2045 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    CBF_2045 (pfkB)
Enzymes [BR:cbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CBF_2045 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188359..2189282)
Genome map
AA seq 307 aa AA seqDB search
MIYTLTTNPAIDMNCSSSSNEAFKVNRTNNLSYSPNGKGVNVSLVLNHYSIESKALGFFG
GFTGKYIVEELDKKNIFTEAFWIEENTRINVFINTEDNKEFKYVNKGPFVSRDTQKDLLK
YLSSNFKKGDYLIISGSLPQSIQEDYYNEILDICMENNVQVILDISSKKLKELLKYKPLL
IKPNDEEVEAIFGLSLKNEEDIKEALKYIYKLGAKNILLTLGEKGMYFYNGEKIYYCNAP
KIKLLSSACAGDSALAAFLSEWLYESNIEKALKKASATGANVAESSALGTFSKVSEYIKK
IHVKEVM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacattaactactaatccagctattgatatgaactgttcttccagtagtaat
gaagcttttaaggtaaatagaaccaataatttatcttattcacctaatggaaaaggagta
aatgtatcactagttttaaatcattattctatagagagtaaagctcttggatttttcgga
ggatttacaggaaagtatattgtagaggaattagataagaaaaatatatttacagaggct
ttttggatagaagaaaatacaaggataaatgtatttataaatacggaagataataaagaa
tttaagtatgtaaacaagggaccttttgtttcaagggatacccaaaaggatctattaaaa
tacttatcatcaaattttaaaaaaggtgattatttaataataagtggaagtcttcctcaa
agtattcaagaggattactacaatgaaattttagatatatgtatggaaaataatgttcaa
gttatattagatataagctctaaaaaattaaaagaattattgaaatataagcctttatta
attaaacctaatgatgaagaagttgaggcaatatttggactaagtttaaaaaatgaagag
gatataaaagaggcattaaaatatatttataagttaggtgctaaaaatatacttctaacc
ttaggggagaaaggaatgtatttttacaatggagagaagatttattattgcaatgcacct
aaaattaaacttttaagctctgcttgtgcaggggattcggccttagcagcatttttaagt
gaatggttatatgaatctaatatagaaaaggcacttaaaaaggcatcagccactggtgca
aatgttgctgaatctagtgcattaggaacttttagtaaagtatcagagtatataaaaaaa
atacatgttaaggaggtaatgtaa

DBGET integrated database retrieval system