KEGG   Clostridium botulinum F 230613: CBF_2826Help
Entry
CBF_2826          CDS       T01865                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbm  Clostridium botulinum F 230613
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CBF_2826
Enzymes [BR:cbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CBF_2826
Exosome [BR:cbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CBF_2826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2970845..2972341)
Genome map
AA seq 498 aa AA seqDB search
MEKYIMSLDQGTTSSRCIIFNKKGEVVSVAQKEFTQIYPKAGWVEHDPLEIWGKQAGVAG
EALNIARISPEQIAGIGITNQRETTVVWNKRTGMPVYNAIVWQCRRTAGYCDELREKGLD
KTIKEKTGLMLDAYFSATKIKWILDNVEGARELAEKGDLLFGNIDTWLIWNMTKGKIHVT
DYTNASRTMLFNIHELKWDEELLEILDIPKSMLPEVKPSSCVYGETDEILFGVSIPISGD
AGDQQAALFGQTCFNAGMAKNTYGTGCFLLMNTGEKAVDSKNGLLTTIAVGIDGKVEYAL
EGSIFIGGAVIQWLRDELRMVKTAQETEKYATEVEDNNGVYLVPAFVGIGAPYWDSYARG
TILGLTRGAKKEHIIRAALESMAYQTHDVLKAMEEDSGIELKALKVDGGACQNNFLMQFQ
SDILGVEVDRPEVVETTALGAAYLAGLAVGYWKDRNEISQNWAISRSFAPAMEDEKKEKL
IKGWHKAVTKAMDWEEKE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatataatgtctttagatcaaggaactactagttcaagatgtataatattt
aataaaaaaggtgaagtagtaagtgttgctcaaaaggaatttacacaaatatatcccaaa
gcaggatgggtagaacatgatccactagaaatatggggaaaacaagcaggggtagcagga
gaagcattaaatatagctagaatttctccagaacaaatagcaggtataggtataactaat
caaagagaaactacagtagtttggaataaaagaacaggaatgccagtatataatgctata
gtatggcaatgtagaagaacagctggttattgtgatgaattaagagaaaaaggtttagat
aaaactataaaagaaaaaacaggtctaatgctagatgcctatttttcagcaacaaaaata
aaatggatattagataatgtagagggagctagggaattagcagaaaaaggtgatttgtta
ttcggaaatatagatacttggttaatctggaatatgacaaaggggaaaattcatgtaaca
gattatactaatgcttcaagaactatgttatttaacatacatgaattaaaatgggatgaa
gaattattagaaatacttgatattcctaaatctatgcttccagaagtaaaaccatctagt
tgtgtatatggtgaaacagatgaaatattgttcggggtatcaattccaatatccggagat
gcaggagatcaacaagcagcattgtttggacaaacttgctttaatgcgggtatggctaaa
aatacttatggtacaggttgtttcttgttgatgaatacaggagaaaaagcagtagattct
aagaatggattattaactactatagctgtgggtatagatggaaaagttgaatatgcttta
gaaggaagtatatttataggtggagcagtaattcaatggctaagagatgaacttagaatg
gtaaaaactgctcaagaaacagaaaaatatgccacagaagtagaagataataatggagtt
taccttgtgccagcttttgttggaataggtgcaccatactgggattcttatgcaagggga
actatattaggccttacaagaggagctaaaaaagaacatataataagagccgcattagaa
tctatggcataccaaactcatgatgttttaaaagctatggaagaggactcaggtatagaa
ctaaaagcattaaaagtagatgggggagcctgtcaaaataatttcttaatgcaatttcaa
tctgatatattaggtgtagaagtagatagaccagaagtagtagagactacagcattagga
gcagcttatcttgcagggcttgcagtaggatattggaaggatagaaatgaaatatcacag
aactgggcaatttcaagaagctttgctccagcgatggaagatgaaaagaaagaaaaactt
ataaaaggatggcataaggcagtaacaaaagcaatggattgggaagaaaaagaataa

DBGET integrated database retrieval system